SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006328 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006328
Domain Number 1 Region: 768-837
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.02e-18
Family TB module/8-cys domain 0.0007
Further Details:      
 
Domain Number 2 Region: 2511-2638
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.49e-18
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 2996-3068
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.89e-18
Family TB module/8-cys domain 0.00053
Further Details:      
 
Domain Number 4 Region: 2717-2786
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.67e-18
Family TB module/8-cys domain 0.00000692
Further Details:      
 
Domain Number 5 Region: 2195-2290
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.76e-17
Family TB module/8-cys domain 0.00000975
Further Details:      
 
Domain Number 6 Region: 3110-3237
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.53e-17
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 269-394
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.33e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 8 Region: 1-85
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.35e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 9 Region: 2062-2199
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.79e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 10 Region: 1015-1147
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.79e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 11 Region: 355-475
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.57e-16
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 12 Region: 2349-2415
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000103
Family TB module/8-cys domain 0.00094
Further Details:      
 
Domain Number 13 Region: 665-749
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000183
Family TB module/8-cys domain 0.002
Further Details:      
 
Domain Number 14 Region: 2794-2916
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000361
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 15 Region: 146-212
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000392
Family TB module/8-cys domain 0.0016
Further Details:      
 
Domain Number 16 Region: 470-540
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000719
Family TB module/8-cys domain 0.0011
Further Details:      
 
Domain Number 17 Region: 893-1019
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000259
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 18 Region: 3236-3352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000879
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 19 Region: 584-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000431
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 20 Region: 2269-2318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000134
Family EGF-type module 0.00049
Further Details:      
 
Domain Number 21 Region: 544-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000636
Family EGF-type module 0.008
Further Details:      
 
Domain Number 22 Region: 50-158
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000157
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 23 Region: 849-902
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000192
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 24 Region: 2672-2720
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000666
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 25 Region: 2631-2675
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000147
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 26 Region: 2430-2478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000159
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 27 Region: 3071-3115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000395
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 28 Region: 2949-2997
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000543
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 29 Region: 1989-2027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000118
Family EGF-type module 0.025
Further Details:      
 
Domain Number 30 Region: 2020-2067
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000173
Family EGF-type module 0.038
Further Details:      
 
Domain Number 31 Region: 2473-2509
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000247
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 32 Region: 2905-2956
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000271
Family EGF-type module 0.024
Further Details:      
 
Domain Number 33 Region: 2311-2354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 34 Region: 628-668
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000381
Family EGF-type module 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006328   Gene: ENSMLUG00000006857   Transcript: ENSMLUT00000006924
Sequence length 3536
Comment pep:putative scaffold:Myoluc2.0:GL429790:8502793:8629461:1 gene:ENSMLUG00000006857 transcript:ENSMLUT00000006924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DYRTGPCFTVVSNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNI
RTGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKFNEVSQKCEDIDECSTIPGIC
DGGECTNTVSSYFCKCPPGFYTSSDGTRCVDVRPGYCYTALANGRCSNQMPQSTTKMQCC
CDIGRCWSPGITLAPEMCPIRATEDYNKLCSVPMVIPERPGYPPPPIGPIPPVHPVPPGF
PPGPGVPGLRPPVDYPYPSREPPRVLPVNVTDYCQLFRHLCQNGRCIPTPGSYRCECNKG
FQLDLRGECIDVDECEKNPCAGGECINNQGSYTCQCRTGYQSTLTRTECRDIDECLQNGR
ICNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICK
PGFQLASDGRYCKDINECETPGICMNGRCVNTDGSYKCECFPGLAVGLDGRVCVDTHMRS
TCYGGYKRGQCVKPLFGAVTKSECCCANTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTS
AGSDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCDNG
QCRNTPGSFVCTCPKGFIYKPDLKTCEDIDECESNPCINGVCKNSQGSFICECSPESTLD
PTKTICIETIKGTCWQTVIDGRCEININGATLKSECCSSLGAAWGSPCTICQVDPICGKG
FSRIKGTQCEDINECEVFPGVCKNGECVNTRGSFKCQCPNGMSLDSTGRICLDIRMETCF
LRYDDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPVRNTPEYEELCPRGPGFATKEI
TNGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPD
LCGRGQCINTPGDFECKCDEGYESGFMMMKNCMDIDECLRDPLLCRGGACLNTEGSYRCE
CPPGHQLSPNISACTDINECELSGNLCPNGRCVNLIGKYQCACNPGYHSTPDRLFCVDID
ECSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPG
EYRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTG
CTDLSHCRLDLSCNKPFSITFTANILLSGISPLFLDYSIKCQMKEITDFNSKCQFATFSK
KTPKYIIILSCAIIPSFKVIDIQNNTNNITIGSKMADSSQIVKISMKLECFSSSLYYSSY
EAWLTVFKISTPHVVSGVQMMLSSLHLWFSSINTEFGIRGKGSGSNEGKGSTVSYCILNS
LKFTPGNRIVCSKFQLRGPCAEANYFRPFTMETAYIFMQCSSCCYCKKEKSSPFILKGLV
EQQSFSKLCEQKHRFEVQEITVSLPKCQHPSTYSTVGRRLQSHGPFDIIPVWPMLFSCEA
EELRILFLVLPLVHELEEIRDKQATQQITMKSRPGRRNFVSREQEKCPLGSITALSKYFS
SLVITDCFHFNNSVQNPPTDLHSQPTQMLGFFFLRKRCPNPGLRRMFDLMEEETLCPWLE
GACWCGPMQGFCCSFCLIVIRQPIRKRRTRLLLGATLGGSWLSQANLQEPSTLMCSLNQL
ARLCASFYLRNVASGSMRENHILQNHQHSVTIVHPLSSSFLSPLIVLHWLSACGNSVGVH
VWPLHSLKRPFPQCLINEMPVCPPRPEAAKQLRAQPLFKWQWNTPKPAPGVCSGHTLALP
GSPANRTFESVRQLWEQTCGGKRTFVQKEMFLANECYVSFTLLKTRVFLKMCAHFKRNCR
FFNCNTKYGKLKIIHMKIKVTLTFLNSCAYLALLYLGRPWNVPGSLIQLVKAPNHMSKAA
WFLLEVLKKPKSLGPCQSFRLNKRVHISCLPSFLFMPLFKRALKILATFCRPKLSSLTQI
NKKVDYEVRCLAFLINTSSKTVIKIKHKWMLNQYIFYCGKCESKSTFDVTKFLSLQLKRP
KRHLCYINECEIGAHNCDRHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQ
HADCKNTMGSYRCLCKEGYTGDGFTCTADLDECSENLNLCGNGQCLNAPGGYRCECDMGF
VPSADGKACEDIDECSLPNICVFGTCHNLPGLFRCECEIGYELDRSGGNCTDVNECLDPT
TCISGNCINTPGSYTCDCPPDFELNPTRVGCVDTRSGNCYLDVRPRGDNGDTACSNEIGV
GVSKASCCCSLGKAWGTPCELCPAVNTSEYKILCPGGEGFRPNPITVILEDIDECQELPG
LCQGGKCINTFGSFQCRCPTGYFLNEDTRVCDDVNECETPGICGPGTCYNTVGNYTCICP
PDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSYNIGRAWNKPCEQ
CPIPSTDEFATLCGSQRPGFVIDIYTGLPVDIDECREIPGVCENGVCINMVGSFRCECPV
GFFYNDKLLVCEDIDECQNGPVCQRNAECINTAGSYRCECKPGYRFTSTGQCNDRNECQE
IPNICSHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECERDACGNGTCRNTIGSFNCR
CNHGFILSHNNDCIDVDECATGNGNLCRNGQCINTVGSFQCECNEGYEVAPDGRTCVDIN
ECVLEPGKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDECVEEPEICALGTCSNTEGS
FKCLCPDGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRNHSKQECCCALKGEGWGDP
CELCPTEPDEAFRQICPYGSGIIVGPDDSAVDMDECKEPDVCKHGQCINTDGSYRCECPF
GYILEGNECVDIDECSVGNPCGNGTCKNVIGGFECTCEEGFEPGPMMTCEDVNECAQNPL
LCAFRCVNTYGSYECKCPAGYVLREDRRMCKDLDECEELKHDCAEKQMECKNLIGTYICI
CGPGYQRTPDGEACVDENECQTKPGICENGRCLNTRGSYTCECNDGFTASPAQDECLDNR
EGYCFTEVLQNMCQIGSSNRNPVTKSECCCDGGRGWGPQCEICPFQGTVAFKKLCPHGRG
FMTNGTDIDECRVIHDVCKNGECVNDRGSYHCICKTGYTPDITGTSCVDLNECNQAPKPC
NFICKNTEGSYQCSCPKGYILQDDGRSCKDLDECATKQHNCQFLCVNTIGSFACKCPPGF
TQHHTACIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDQSGASCEDVDECEGNH
RCQHGCQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHICGGASCHNTLGSYKCMCPT
GFQYEQFSGGCQDINECGSSQAPCSYGCSNTEGGYLCGCPPGYFRIGQGHCVSGMGMGRG
GPEPPASGEMDDNSLSPEACYECKINGYPKRGRKRRSANETDASHIEDQPEKEANVSLAS
WDAEKIAMFAFNISHISNKVRILELLPALTTLTNHNRYLIESGNENGFFKINQKEGISYL
HFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQILLH
Download sequence
Identical sequences G1P849
ENSMLUP00000006328 ENSMLUP00000006328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]