SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006372 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006372
Domain Number 1 Region: 601-796
Classification Level Classification E-value
Superfamily Sec7 domain 6.67e-73
Family Sec7 domain 0.00000175
Further Details:      
 
Domain Number 2 Region: 365-547,1056-1442,1615-1723
Classification Level Classification E-value
Superfamily ARM repeat 1.71e-28
Family Armadillo repeat 0.099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006372   Gene: ENSMLUG00000006936   Transcript: ENSMLUT00000006971
Sequence length 1752
Comment pep:putative scaffold:Myoluc2.0:GL429857:1188714:1253835:-1 gene:ENSMLUG00000006936 transcript:ENSMLUT00000006971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEIKAEIEKQRLGTAAPPKANFIEADKYFLPFELACQSKSPRVVSTSLDCLQKLIAYGHI
TGNAPDSGAPGKRLIDRIVETICNCFQGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTIL
QTVRTCYNIYLASKNLINQTTAKATLTQMLNVIFTRMENQVFQEIRELEKPVQSKPQSPV
IQAAAGSPKFSHLKQSEAQSKPTTPEKTDLTNGAHDTSGSEKVSSENGDAPRERSSSLSE
KLYPPSGTYDGAQEVVKEILEDVVTSAVKEAAQKHSLTESERALGELEGQECAVPSAVDE
NSQTNGIADDRQSLSSADNLESDAQGHQVAARFSHILQKDAFLVFRSLCKLSMKPLGEGP
PDPKSHELRSKVVSLQLLLSVLQNAGPVFRTHEMFINAIKQYLCVALSKNGVSSVPDVFE
LSLAIFLTLLSNFKMHLKMQIEVFFKEIFLNILETSTSSFEHRWMVIQTLTRICADAQCV
VDIYVNYDCDLNAANIFERLVNDLSKIAQGRSGHELGMTPLQELSLRKKGLECLVSILKC
MVEWSKDLYVNPNHQTSLGQERPTDQEMGDGKGLDMARRSSVTSMESTVSSGTQTTIQDD
PEQFEVIKQQKEIIEHGIELFNKKPKRGIQFLQEQSMLGTSVEEIAQFLHQEERLDSTQV
GDFLGDSTRFNKEVMYAYVDQLDFCEKEFVSALRTFLEGFRLPGEAQKIDRLMEKFAARY
IECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEE
YLSSIYEEIEGKKIAMKETKEHTIATKSTKQNVASEKQRRLLYNLEMEQMAKTAKALMEA
VSHAKAPFTSATHLDHVRPMFKLVWTPLLAAYSIGLQNCDDTEVASLCLEGIRCAIRIAC
IFGMQLERDAYVQALARFSLLTASSSITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEIL
KCISQLELAQLIGTGVKTRYLSGSGREREGSLKGHTLVGEEFMGLGLGNLVSGGVDKRQM
ASFQESVGETSSQSVVVAVDRIFTGSTRLDGNAIVDFVRWLCAVSMDELASPHHPRMFSL
QKIVEISYYNMNRIRLQWSRIWHVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGE
LANFRFQKDFLRPFEHIMKKNRSPTIRDMVIRCIAQMVNSQAANIRSGWKNIFAVFHQAA
SDHDGNIVELAFQSTGHIVTTIFQHHFPAAIDSFQDAVKCLSEFACNAAFPDTSMEAIRL
IRFCAKYVSERPRVLQEYTSDDMNVAPGDRVWVRGWFPILFELSCIINRCKLDVRTRGLT
VMFEIMKSYGHTFEKHWWQDLFRIVFRIFDNMKLPEQQSEKSEWMTTTCNHALYAICDVF
TQFYEALNEVLLSDIFAQLQWCVKQDNEQLARSGTNCLENLVISNGEKFSPDVWDKTCSC
MMDIFKTTIPHVLLTWRPVGMEEDSSEKHLDVDLDRQSLSSIDKNASERGQSQLSNPTDE
SWKGRPYANQKLFASLLIKCVVQLELIQAIDNIVFYPATSKKEDAEHMVAAQQDTLDADI
HIETEDQGMYKCMSSQHLFKLLDCLQESHSFSKAFNSNYEQRTVLWRAGFKGKSKPNLLK
QETSSLACCLRILFRMYVDENRRDSWEEIQQRLLNVCSEALAYFITVNSESHREAWTSLL
LLLLTKTLKINDEKFKAHASKYYPYLCEIMQFDLIPELRAVLRKFFLRIGVVYKIWIPEE
PSQAAGTLSPVW
Download sequence
Identical sequences G1P884
ENSMLUP00000006372 ENSMLUP00000006372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]