SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006433 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006433
Domain Number 1 Region: 25-141,191-276
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.73e-18
Family DNA gyrase/MutL, N-terminal domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006433   Gene: ENSMLUG00000007007   Transcript: ENSMLUT00000007040
Sequence length 1032
Comment pep:putative scaffold:Myoluc2.0:GL430384:144669:182189:1 gene:ENSMLUG00000007007 transcript:ENSMLUT00000007040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFTNYSSLNRAQLTFEYLHTNSTTHEFLFGALAELVDNARDADATRMDIYAERREDLRG
GFMLCFLDDGAGMDPNDAASVIQFGKSAKRTPESTQIGQYGNGLKSGSMRIGKDFILFTK
KDDTMTCLFLSRTFHEEEGIDEVIVPLPTWNARTRDPLTDNLEKFSIETELIYKYSPFHN
EEEVMTQFMKIPGDSGTLVIIFNLKLMDNGEPELDIVSNPRDIQMAETSPEGTKPERRSF
RAYAAVLYIDPRMRIFIHGHKVQTKRLSCCLYKPRMYKYTSSRFKTRAEQEVKKAEHVAR
IAEDKAREAESKARALELRLGGDLTRDSRVMLRQVQNTAITMRREADVKKRIKDAKQRAL
KEPKELNFIFGVNIEHRDLDGMFIYNCSRLIKMYEKVGPQLEGGMACGGVVGVVDVPYLV
LEPTHNKQDFADAKEYRHLLRAMGDHLAQYWKDIAIAQRGIVKFWDEYGYLSANWNHPPS
SDVRYKRRRSMEIPTTIQCDLCLKWRTLPFQLHSVEKEYPDTWVCSMNPDPEQDRCEASE
QKQKVPLGTLKKDLKTPEEKQKQLTEKIRQQQEKLEAMQKTTPIRSQADLKKLPLEVTTR
PSSEEPARRPQRPRSPPLPAVIKNAPSRPPALHTPRPTRKAPAISSTPKPPALAAREEAC
TSRLLQPPEAPRKPANTAVKTVPRPTPPVQPLSPSLLPNSKSPRDVPTPRAVKMPVVKKP
EPPSKPPPATPGRKRALDASDEEEAEEEAERRKERPKRGKITVKEEKKDLSELSDSAEED
SADLKKAQKDKGLHVEVRVNKEWYTGRVTAVEAGKHAVRWKVKFDYVPTDTTPRDRWVEK
DSEDVRLMKPPSPEYQSPDTQQGGGEEESTKAPLVEAQPAVAVTDPSTSDCTRIEPDTTA
PSSNHETIDLLVQILRNCLRYFLPPSFPISKKELSAMNSDELISFPLKEYFRQYEVGLQN
LCHSYQSRADSRAKASEESLRTSEKKLRETEEKLQKLRTNIVALLQKVQEDIDINTDDEL
DAYIEDLITKGD
Download sequence
Identical sequences G1P8D8
XP_006104942.1.53796 ENSMLUP00000006433 ENSMLUP00000006433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]