SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006554 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006554
Domain Number 1 Region: 135-378
Classification Level Classification E-value
Superfamily VPS9 domain 1.31e-55
Family VPS9 domain 0.001
Further Details:      
 
Domain Number 2 Region: 666-887
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.96e-51
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 3 Region: 394-427,459-605
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.39e-45
Family Ankyrin repeat 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006554   Gene: ENSMLUG00000007152   Transcript: ENSMLUT00000007183
Sequence length 1048
Comment pep:putative scaffold:Myoluc2.0:GL429931:2935538:2991087:1 gene:ENSMLUG00000007152 transcript:ENSMLUT00000007183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALYDEDLLKNPFYLALQKWRPDLCNKVAQLHGIVLVPCKGSLTSNVQSTCQFESYILKP
VEEHFQTLNGKDVFIQGNRIKLGAGFACLLSVPILFEETFYNEKEESFSLLCIAHPLEKR
ESSEEPPTPSDTFSLKTIEDVREFLGRHSERFDKNIASFQRTFRECERKSLRHHIDAVNA
LYTKCLQHLLKDSHLKMLARHEAQMNLMKQAVEMYVQHDIYDLIFKYVGTMEASEDAAFN
KITRSLQDLQQKDIGVKPDFSFNIPRAKRELAQLNKCTSPQQKLVCLRKVVQLITQSPSQ
RVNLETMCADDLLSVLLYLLVKTEIPNWMANLSYIKNFRFSNSTKDELGYCLTSVEAAIE
YIRQGSLSVKPLESEGFGDRLFLKQRMSLLSQMTSTPIDCLFKHIASGNQKEVERLLSQE
DQDKDAIQKMCHPLCFCDDCEKLVSGRLNDPSVVTPFSRDDRGHTPLHVAALCGQASLID
LLVSKGAVVNATDYHGSTPLHLACQKGYQSVTLLLLHYKASADVQDNNGNTALHLACAHG
HEDCVKALVYYDVQSCRLDIGNEKGDTPLHIAARWGYQGIIETLLQNGASTEIQNRMKET
PLKCALNSKILSIMEARHMSFERRQQSSAVPVPPPQHFMDSISQGSSASSFSSVSTSSRK
REPKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDVEDAVSAADLEFCHPLCQCPKC
APAQKKLAKVPASGLGVNVTHQDGSSPLHVAALHGRADLIPLLLKHGANVAARNANQAVP
LHLACQQGHFQVVKYLLDSNAKPNKKDVSGNTPLMYACSSGHHEVAALLLQHGASINASN
NKGNTALHEAVIEKHVFVVELLLLHGASVQLLNKRQCTAIDYAEQNSKIMELLQVVPSCV
ATLDDVGETDHKEYVTVKIRKKWNSKMYNLQDEPFTRQFYFVHSVGQFKGRTSREIMARD
KSVPNFPEESSHEPGRQKVTQKQKNLSDQSTSQTADKGDGDQPRPGLKQTAPGNTRMLRR
HTVKDTATEGPETADNPTTPHEASVSQS
Download sequence
Identical sequences G1P8P2
ENSMLUP00000006554 ENSMLUP00000006554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]