SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006636 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006636
Domain Number 1 Region: 215-381,679-897,952-1004
Classification Level Classification E-value
Superfamily Ras GEF 1.96e-114
Family Ras GEF 0.00011
Further Details:      
 
Domain Number 2 Region: 363-448
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-18
Family PDZ domain 0.0041
Further Details:      
 
Domain Number 3 Region: 93-218
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000000263
Family cAMP-binding domain 0.0008
Further Details:      
 
Domain Number 4 Region: 589-668
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000388
Family Ras-binding domain, RBD 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006636   Gene: ENSMLUG00000007240   Transcript: ENSMLUT00000007272
Sequence length 1484
Comment pep:putative scaffold:Myoluc2.0:GL429768:26782041:26830250:-1 gene:ENSMLUG00000007240 transcript:ENSMLUT00000007272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATESEAGDMDLSGLPE
TAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANMT
MSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPDGKAEILCMGNSFG
VSPTMDKEYMKGVMRTKVDDCQFVCIAQQDYCRILNQVEKNMQKVEEEGEIVMVKEHREL
DRTGTRKGHIVIKGTSERLTMHLVEEHSVVDPTFIEDFLLTYRTFLSSPMEVGKKLLEWF
NDPSLRDKVTRVVLLWVNNHFNDFEGDPAMTRFLEEFENNLEREKMGGHLRLLNIACAAK
AKRRLMTLTKPSREAPLPFILLGGSEKGFGIFVDSVDSGSKATEAGLKRGDQILEVNGQN
FENIQLSKAMEILRNNTHLSITVKTNLFVFKELLTRLSEEKRNGAPHLPKIGDIKKASRY
SIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKTRISILPQKPYNDIGIGQSQD
DSIVGLRQTKHIPTALPVSGTLSSSNPDLLQSHHRILDFSTTPDLPDQVLRVFKADQQSR
YIMISKDTTAKEVVIQAIREFAVTATPDQYSLCEVSVTPEGVIKQRRLPDQLSKLADRIQ
LSGRYYLKNNMETETLCSDEDAQELLRESQISLLQLSTVEVATQLSMRNFELFRNIEPTE
YIDDLFKLKSKTSCANLKKFEEVINQETFWVASEILRETNQLKRMKIIKHFIKIALHCRE
CKNFNSMFAIISGLNLAPVARLRTTWEKLPNKYEKLFQDLQDLFDPSRNMAKYRNVLNSQ
NLQPPIIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMIAKEIRHVGRMASVNMDPALM
FRTRKKKWRSLGSLSQGSANATVLDVAQTGGHKKRVRRSSFLNAKKLYEDAQMARKVKQY
LSNLELEMDEESLQTLSLQCEPATNTLPKNPGDKKPVKTETSPVAPRAGSQQKAQPQPQP
QPPQPPHKVNQGLQVPAVSLYPSRKKVPVKDLPPFGINSPQALKKILSLSEEGSLERHKK
QAEDTISNASSQLSSPPTSPQSSPRKGYTLAPSGTVDNFSDSGHSEISSRSSIVSNSSFD
SVPVSLHEERRQRHSVSIVETNLGVGRMERRTMIEPDQYRSYAPMSESRGLYATATVISS
PSTEELSQDQGDRASLDAADSGRGSWTSCSSGSHDNIQTIQHQRSWETLPFGHTHFDYSG
DPASVWASSSHMDQMMFSDHSTKYNRQNQSRESLEQAQSRASWASSTGYWGEDSEGDTGT
IKRRGGKDVSLEAESSSMPPVTTEETKPVPMPAHIAVTPTTAKGLIGWCLVFTAARKEGR
YREPPPTPPGYIGIPITDFPDGHSHPTRKPPDYNVALQRSRMVARPSEAAGPSPAQQPHA
HPGAGRPVNKPQWHKPNECDPRLAPYQSQGFSAEEDEDEQVSAV
Download sequence
Identical sequences G1P8W8
ENSMLUP00000006636 ENSMLUP00000006636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]