SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006738 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006738
Domain Number 1 Region: 786-840
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000131
Family Laminin-type module 0.0000641
Further Details:      
 
Domain Number 2 Region: 682-733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000254
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 244-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000586
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 4 Region: 895-945
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 5 Region: 844-892
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000865
Family Laminin-type module 0.00032
Further Details:      
 
Domain Number 6 Region: 405-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 7 Region: 356-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 300-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 9 Region: 731-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.00029
Further Details:      
 
Domain Number 10 Region: 943-988
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000204
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000006738
Domain Number - Region: 58-136
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00187
Family Galactose-binding domain 0.037
Further Details:      
 
Domain Number - Region: 1247-1487
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006738   Gene: ENSMLUG00000007336   Transcript: ENSMLUT00000007382
Sequence length 1570
Comment pep:putative scaffold:Myoluc2.0:GL429821:6682952:6784972:1 gene:ENSMLUG00000007336 transcript:ENSMLUT00000007382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGGKSGLRIARVVKGTYSFTVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHG
AAFLTDYNNQADTTWWQSQTMLAGVQYPNSINLTLHLGKSFDITYVRLRFHTSRPESFAI
YKRTREDGPWVPYQYYSGSCENTYFKINRGFIRTGEDEQQALCTDEFSDISPLTGGNVAF
STLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFSV
GGRCKCNGHASECVKNEHNKLVCDCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPC
DCNGRSRECYFDPELYRSTSHGGHCTNCQDNTDGAHCERCRENFFRLGNTEPCSPCHCSP
VGSLSTQCDSYGRCSCKPGVMGDKCDRCQPGFHSLTEAGCRPCACNPSGSTDECNVETGR
CVCKDNVEGFNCERCKPGFFNLEPSNPRGCTPCFCYGHSSVCTNAVGYSVYSVTSTFQTD
EDGWHAEQRDGSESSLEWSPERQDIAVISDSYFPRYFIAPAKFLGKQVMSYGQNLSFSFR
VDRRDTRLSAEDVVLEGAGLRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPTLTPF
EFQKLLNNLTSIKIRGTYSERSAGYLDDVTLATARPGPGVPATWVETCTCPVGYGGQFCE
MCISGYRRETPSLGPYSLCVLCTCNGHSETCDPETGVCNCRDNTAGPNCEKCSDGYYGDP
TAGTSSDCQPCPCPGGSSCAVVPTTQEVVCTNCPTGTTGKRCELCDDGYFGDPQGTHGPV
RLCRLCQCNANIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCK
ALACDCNPYGTSRQQSGCSPVTGQCDCLPHVTGRDCGACEPGFYNLHSGQGCQRCDCHAL
GSTNGQCDIRTGQCECQPGITGQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGR
CECREGFVGNRCDQCEENYFYNRSWPGCQECPACYRLVKDKVAEHRVKLQELETLMANLG
TGGEVVPDQAFEDRLKEAEREVMDLLREAQDVKDVDQNLMDRLQRVNNSLSSQISRLQNI
RNTIEETGNLAEQARARVESTEQLIEIASRELEKAKVAVANVSITQPESTGDPNNMTLLA
EEARRRGSLRHKQEADDIVRVAQTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQA
KNISQDLEKQAARVHEEAKRAGEKAVEIYASVSQLSPVDSGALENEANKIKKEAEELDRL
IDQKLKDYEDLRDDMRGKEFEVKKLLEGGKVEQQTADQLLARADAAKALAEEAAKRGRNT
LQEANDILNNLKDFDKRVNDNKTAAEEALRRIPAINQTIFVANERTREAQLALGNAAADA
TEAKNKAHEAERIASAVQKNATSTKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKKKQ
DDADQDMMMAGMASQAAQEAEINARKAKNSVSSLLNLINNLLEQLGQLDTVDLNKLNEIE
GTLNKAKDEMKVSDLDRKVSDLENEARKQEAAIRDYNRDIEEIMKDIHNLEDIRKTLPSG
CFNTPSIEKP
Download sequence
Identical sequences G1P954
ENSMLUP00000006738 ENSMLUP00000006738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]