SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007066 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007066
Domain Number 1 Region: 245-366
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-23
Family SH2 domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007066   Gene: ENSMLUG00000007709   Transcript: ENSMLUT00000007738
Sequence length 385
Comment pep:putative scaffold:Myoluc2.0:GL430334:184814:245018:-1 gene:ENSMLUG00000007709 transcript:ENSMLUT00000007738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMSPPVQERNFPAVRDGAEGPEDDDYEDPNVHVEEGWQWMKILPARPIKESEYADTRYFK
GMMDTPLSLGAKIPIPAERQAWTTQMRLEEVDKPTTKDIRSQHAKGDKPSTRNKTPLPPP
RLPVVIIPKKYQPLPPEPEGDVSPSPQRHPFPEVQRGPRQITLKNLNEVLGAEKAPHPLT
KPESSHGTQNQSAPEIPLAVASSSFMMSNHNMQSRDRKESTQSHAPQRCQAPARCGPRED
ALHYKNMNWRKPCPTRSDEEEAQHSEWYVGEYSRQEVEEALMKENKDGMFLVRDCSAKSC
TEPYVLVVFHGNRVYNVKIRFLERNRQFALGTGLRGDEKFDSVEDIIEHYKYFPIVLIDG
KDKTRAHREQCYLTRPLPLNRLSSL
Download sequence
Identical sequences G1P9Y4
ENSMLUP00000007066 ENSMLUP00000007066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]