SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007130 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007130
Domain Number 1 Region: 605-715
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-24
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 428-539
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-21
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 3 Region: 722-787
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000135
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 258-365
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000955
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 5 Region: 849-908
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000117
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 781-843
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000167
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 7 Region: 369-430
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000153
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 8 Region: 544-608
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000229
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007130   Gene: ENSMLUG00000007797   Transcript: ENSMLUT00000007807
Sequence length 1002
Comment pep:putative scaffold:Myoluc2.0:GL430158:534565:575305:-1 gene:ENSMLUG00000007797 transcript:ENSMLUT00000007807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDAPLEGDTGPSSTYLLPSGALGGGSLSKDSLEEKVTPAPPSPAQSGEERQDPELDGTTA
SERPDPVALSTLLPEEPGTKLASLPRKKLSSLKQANSSRKQLRPKATSAAGLLRVGSQPA
SPGLGLPSSATEKPGPPGDPDPVASEGEETFRLPSSEEPLWLDRRRGAVPTTPAPLQISP
FTSQPYMAQTLPQRPDPGEPTVPDEAQEAPLEDASPMTLMDKGENELTGSASEESQETTT
STIITTTVITTEQAPALCSVSLSDPEGYIDSSDYPPLPLSSFLECTYNVTVYTGYGVELQ
VKSVNLSEGELLSIRGVDGPTLTVLANQTLLVEGQVIRSPTNTISVYFRTFQDDGLGTFQ
LHYQAFMLSCSFPRRPDYGDVTVMDLHSGGVAHFHCHLGYELQGAKTLTCINASKPHWSS
HEPICSAPCGGTVHNATIGHVLSPSYPGNANGSQFCVWTIEAPEGQKLHLHFERLLLHEK
DRMMIYSGLTNKSALLYDSLHTESVPFEGLLSEGNSIRIEFTSDQARAASSFNIRFEAFE
KGHCYEPYIQNGNFTTSDLTYNIGTIVEFTCDPGHSLEQGPAVIECVNVRDPYWNDTEPL
CRAMCGGELSAVAGVVLSPNWPEPYAEGEDCIWKIHVGEEKRIFLDIQFLNLSNSDILTI
YDGDEVMPHILGQYLGSSGPQKLYSSTPDLTIQFHSDPAGLIFGKGQGFIMNYVEVSRND
SCSDLPEIQNGWKTTSHTELVRGARITYQCDPGYDIVGSDTLTCQWDLSWSSDPPFCEKI
MYCTDPGEVDHSTRLISDPVLLVGTTIQYTCEPGFVLEGSSLLTCYSRETGTPIWTSRLP
HCVSEESLACDNPGLPENGYQILYKRLYLPGESLTFMCYEGFELMGEVTIRCILGQPSHW
NGPLPVCKVNQDSFEHALEVAEAAAETSLEGGTMALAIFIPVLIISLLLGGAYIYINRLC
RYYSNLRLPLMYSHPYSQITVETEFDNPIYETGETREYEVSI
Download sequence
Identical sequences G1PA34
ENSMLUP00000007130 ENSMLUP00000007130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]