SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007155 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007155
Domain Number 1 Region: 381-484
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 2 Region: 153-271
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-24
Family Cadherin 0.00046
Further Details:      
 
Domain Number 3 Region: 264-359
Classification Level Classification E-value
Superfamily Cadherin-like 1.41e-21
Family Cadherin 0.0009
Further Details:      
 
Domain Number 4 Region: 484-592
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-18
Family Cadherin 0.0024
Further Details:      
 
Domain Number 5 Region: 82-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000514
Family Cadherin 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007155   Gene: ENSMLUG00000007826   Transcript: ENSMLUT00000007834
Sequence length 793
Comment pep:putative scaffold:Myoluc2.0:GL429767:59857330:60072445:1 gene:ENSMLUG00000007826 transcript:ENSMLUT00000007834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKITSTSCICPVLVCLCFVQRCYGTAHHSSIKVTRNQTKHIEGETEVHHRPKRGWVWNQF
FVLEEHMGPDPQYVGKLHSNSDKGDGSVKYILTGEGAGTIFIIDDTTGDIHSTKSLDREQ
KTHYVLHAQAIDRRTNKPLEPESEFIIKVQDINDNAPKFTDGPYIVTVPEMSDMECTGTS
VLQVTATDADDPTYGNSARVVYSILQGQPYFSVDPKTGVIRTALHNMDREAREHYSVVIQ
AKDMAGQVGGLSGSTTVNITLTDVNDNPPRFPQKHYQLYVPESAQVGSAVGKIKANDADT
GSNADMTYSIINGDGIGIFSISTDKETREGILSLKKPLNYEKKKSYTLNIEGANTHLDFR
FSHLGPFKDATMLKIIVGDVDEPPLFSMPSYIMEVYENAKVGTVVGTVLAQDPDSANSLV
RYFIDYNAEDDRFFNIDANTGSIKTTKVLDREETPWYNITVAASENDNPGLLSHVTVGIR
VLDVNDNPPELAREYDIVVCENSKPGQVIHTISATDKDDFANGPRFNFFLDEHLSINPNF
TLKDNEDNTASILTRRRRFSRTIQDVYYLPIMISDGGIPSLSSSSTLTIRVCACERDGRV
RTCHPEAFLSSTGLSTGALIAILLCVVILLAIVVLFITLRRSKKEPLIISEEDVRENVVT
YDDEGGGEEDTEAFDITALRNPSAAEELKYRRDIRPEVQLTPRHQTLSTLESIDVQEFIK
QRLAEADLDPSVPPYDSLQTYAYEGQRSEAGSISSLDSATTQSDQDYQYLGDWGPEFKKL
AELYGEMESERTT
Download sequence
Identical sequences G1PA58
ENSMLUP00000007155 ENSMLUP00000007155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]