SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007171 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007171
Domain Number 1 Region: 96-200
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000141
Family Pleckstrin-homology domain (PH domain) 0.0097
Further Details:      
 
Domain Number 2 Region: 510-573,624-655
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000329
Family Second domain of FERM 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000007171
Domain Number - Region: 402-495
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0344
Family Ubiquitin-related 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007171   Gene: ENSMLUG00000007840   Transcript: ENSMLUT00000007855
Sequence length 793
Comment pep:putative scaffold:Myoluc2.0:GL429867:1230899:1239111:1 gene:ENSMLUG00000007840 transcript:ENSMLUT00000007855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPGGLWWLLCCRRGFTLLHREYGTTEPSARPGEPPWESGGDGPAPAPGGGGGRGPLDV
TLTQPVRSGPISDRLQSWEETRSLIPEKGPLEDDADVVVKGWLYREPRGRGPRPWLPPRR
AWFVLTRDSLDQFSSSGKGARRLGSLVLTSLCSVTGPERRPKETGLWLVTVSGRKHSVRL
CSPRQAEAERWGVALREVIASKAPLETPTQLLLRDIQESCGDPEAVALIYRRNPILRHTS
GALYAPLLPLPYGVSAPGPGYAPLREEAVRLFLALQALEGARRPGPLMQGVLQTCRDLPA
LRDELFLQLAKQTSGPAGPPGLPATQDPAALRYWQLLTCMSCTFRPGGAVRGHLLGHLER
TEQALPDSELAEYARFIRRALGRTRGRELVPSLAEISALSRRQELLCTVHCPGAGACPVA
IDSHTTAAEVARELVGRLGLARSRNAFALYQQRGAQERALAGGTLMADVLTRFENLAAEE
ATALEDSPDAGWRLCLRLHGPLRPEGLSPDGHELPFLFEQAHALLLRGRPPPPEDTLRAL
AALRLQSLHRDFSPRAPLPRLDRLLPPPTPPREDPPRPIPRPPPSAALLAGAIWSSGLAK
RRAERARRIGAGRPAGSVVREGGGGAGMAAAVLGGWKRLRGMGRAEAMAAYLALAAQCPG
FGAARYEVLELSTEPGGGAPQKLCLGLGAKAMSLSRPGETEPIHSVSYGHVAACQLMGPH
TLALRVKEAGWRVRQVEEIMQLVNAYLANPSPERPCSSPSSSCQDLPDSSSPSQHPGLDE
PQGHSGCLGQLPK
Download sequence
Identical sequences G1PA72
ENSMLUP00000007171 ENSMLUP00000007171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]