SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007185 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007185
Domain Number 1 Region: 140-266
Classification Level Classification E-value
Superfamily PX domain 2.35e-31
Family PX domain 0.001
Further Details:      
 
Domain Number 2 Region: 303-514
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000356
Family BAR domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007185   Gene: ENSMLUG00000007851   Transcript: ENSMLUT00000007870
Sequence length 519
Comment pep:putative scaffold:Myoluc2.0:GL429767:6398640:6459440:-1 gene:ENSMLUG00000007851 transcript:ENSMLUT00000007870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEREPPPLGDGKPADFEEQEDGEDLFTSTVTTLESIPSSPEPISLLTEDVSTNSNGPK
PAEVVLEDDTEDLFAEATEEVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSA
PVIFDRSREEIEEEANGDIFDIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKNEFSV
KRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDLSSTEFVEKRRAALE
RYLQRTVKHPTLLQDPDLRQFLESSELPRAVNTQALSGAGILRMVNKAADAVNKMTIKMN
ESDAWFEEKQQQFENLDQQLRKLHANVEALVCHRKELSANTAAFAKSAAMLGNSEDHTAL
SRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDA
QITLLKKRETEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGRFEK
ERVKDFKTVIIKYLESLVQTQQQLIKYWEAFLPEAKAIA
Download sequence
Identical sequences G1PA84
XP_006081158.1.53796 ENSMLUP00000007185 ENSMLUP00000007185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]