SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007215 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007215
Domain Number 1 Region: 430-1182
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 3.66e-250
Family Type II DNA topoisomerase 0.00000000000417
Further Details:      
 
Domain Number 2 Region: 31-263
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.62e-63
Family DNA gyrase/MutL, N-terminal domain 0.00000025
Further Details:      
 
Domain Number 3 Region: 254-415
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.28e-41
Family DNA gyrase/MutL, second domain 0.0000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007215   Gene: ENSMLUG00000007831   Transcript: ENSMLUT00000007901
Sequence length 1523
Comment pep:putative scaffold:Myoluc2.0:GL430096:1043659:1070981:-1 gene:ENSMLUG00000007831 transcript:ENSMLUT00000007901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVSPLQPVNENMQINKKKNEDAKKRLSIERIYQKKTQLEHILLRPDTYIGSVELVTQQM
WVYDEDIGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNN
GKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVET
ASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMVR
RAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKVDETGNPLKVIHEQVNHRWEVCL
TMSEKGFQQISFVNSIATSKGGRHVDYVTDQIVTKLVDVVKKKNKGGVAVKAHQVKNHMW
IFVNALIENPTFDSQTKENMTLQAKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQV
QLNKKCSAVKHNRIKGIPKLDDANDAGSRNSADCTLILTEGDSAKTLAVSGLGVVGRDKY
GVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTD
QDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMSFYSLPEFEEWKNS
TPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQTDDR
KEWLTHFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDG
LKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNL
NLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPPKDDNTLKFLYDDNQRVEPEWY
IPIIPMVLINGAEGIGTGWSCKIPNFDIREVVNNIRRLMDGEEPLPMLPSYKNFKGTIEE
LASNQYVISGEVAILNSTTIEISELPIRTWTQTYKEQVLEPMLNGTEKTPPLITDYREYH
TDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILRD
FYELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQRG
YDSDPVKAWKEAQQKVTEEEENEESDNEKETEKSDSASGPTFNYLLDMPLWYLTKEKKDE
LCKQRNEKEQELETLKRKSPSDLWKEDLAAFIEELEAVEAKEKQDEQVGLPGKGGKGKGK
KTQMAEVLPSPSGKRVVPRVTIEMKAEAEKKIRRKIKNENTEGSPQEDSVEPESLKQRLE
KKQKREPGNKAKKQTTLPFKPIQKGKKRNPWSDSESDMSGNESDFDVPPREVEPRRAATK
AKFTVDLDSDEDFSDIDKKSEDEDFVPSDASPVKTKTSPKHTNKELKPQKSTTSVKRGSR
LLSWGGQIHLGSNADYISQALPLKINVTVKKTAAKSQSSTSTTGAKKRAAPKGTKKDPSL
TSDVPQKPDPPKTKIRRKRKASSSDDSDSNFEKMISKAVTSKKSKGESDDFHMDLDSAVA
PRVKSGRTKKPIKYLEESDEDLF
Download sequence
Identical sequences G1PAB1
ENSMLUP00000007215 ENSMLUP00000007215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]