SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007684 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007684
Domain Number 1 Region: 18-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000172
Family Ubiquitin-related 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007684   Gene: ENSMLUG00000008415   Transcript: ENSMLUT00000008420
Sequence length 308
Comment pep:putative scaffold:Myoluc2.0:GL430077:1017336:1020300:1 gene:ENSMLUG00000008415 transcript:ENSMLUT00000008420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLFFEVEILDAKTREKLCFLDKVEPHATIAEIKNLFTKSHPQWYPARQSLRLDPKGKSLK
DEDVLQKLPVGTTATLYFRDLGAQISWVTVFLTEYAGPLFIYLLFYFRVPFIYGHKYDFT
SSRHTVVHLACICHSFHYVKRLLETLFVHRFSHGTMPLRNIFKNCTYYWGFAAWMAYYIN
HPLYTPPTYGAQQVKLALAIFVICQLGNFSIHMALRDLRPAGSKTRKIPYPTKNPFTWLF
LLVSCPNYTYEVGSWIGFAIMTQCLPVALFSLVGFIQMTIWAKGKHRSYLKEFRDYPPLR
MPIIPFLL
Download sequence
Identical sequences G1PBF7
ENSMLUP00000007684 ENSMLUP00000007684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]