SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000007783 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000007783
Domain Number 1 Region: 14-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-92
Family Calponin-homology domain, CH-domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 3 Region: 603-741
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-31
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 4 Region: 1010-1165
Classification Level Classification E-value
Superfamily Spectrin repeat 6.22e-29
Family Spectrin repeat 0.0000216
Further Details:      
 
Domain Number 5 Region: 2190-2283
Classification Level Classification E-value
Superfamily PH domain-like 7.96e-29
Family Pleckstrin-homology domain (PH domain) 0.0000182
Further Details:      
 
Domain Number 6 Region: 1222-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 6.27e-28
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 7 Region: 1858-2012
Classification Level Classification E-value
Superfamily Spectrin repeat 5.88e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 8 Region: 1752-1906
Classification Level Classification E-value
Superfamily Spectrin repeat 6.31e-27
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 9 Region: 811-951
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-26
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 10 Region: 1452-1589
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-25
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 11 Region: 425-528
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 12 Region: 1594-1695
Classification Level Classification E-value
Superfamily Spectrin repeat 2.52e-22
Family Spectrin repeat 0.00095
Further Details:      
 
Domain Number 13 Region: 529-637
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-22
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 14 Region: 1383-1481
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-18
Family Spectrin repeat 0.00049
Further Details:      
 
Domain Number 15 Region: 2017-2078
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000317
Family Spectrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000007783
Domain Number - Region: 1169-1241
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0158
Family Spectrin repeat 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000007783   Gene: ENSMLUG00000008419   Transcript: ENSMLUT00000008538
Sequence length 2337
Comment pep:putative scaffold:Myoluc2.0:GL429773:7574128:7751189:-1 gene:ENSMLUG00000008419 transcript:ENSMLUT00000008538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALL
LWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQA
VVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYI
MDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIGIQAERVRGVNASAQKFATDGEG
YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKI
LSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERII
YIREQWAHLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQ
SLVRKHKDVAEEIANYRPTLDTLHEQAGALPQEHAESPEVRGRLSGIEERYKEVAELTRL
RKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNN
QASRVAVVNQIARQLMHSGHPNEKKIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNY
HLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTMERDLVAIEAKLSDLQKEAEK
LESEHPDQAQGILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRT
QTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLR
QRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTL
EGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNR
EAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMA
ELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANK
AELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQS
QAQALSQEGESPDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWV
GERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQSIVTDSSSLNAE
AIRQRLADLRQLWGLLIEETEKRHRRLEEAQRAQQYYFDAAEAEAWMSEQELYMMSEEKA
KDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYA
GLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFR
EFARDTGNIGQERVDTVNHMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQIL
AASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVR
QLQEDAARLQAAYAGDKADDIQKRENEVLEAWKALLDSCEGRRVRLVDTGDKFRFFSMVR
DLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARK
HYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLS
SREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPP
SPEPSTKVSEDTESQQQWDTSKGEQVSQNGLPAEQGSPRMADTADTSDMVNGAAEQRTSS
KESSPIPSPTSDRKAKTALPAQSAATLPARTQEMPSAQMEGFLNRKHEWEAHNKKASSRS
WHNVYCAVSLKEAICEVALDYKKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQAISSAIS
ADKHEVSASTQGTPASSRAQTLPTSVVTITSESSPGKREKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences G1PBN3
ENSMLUP00000007783 ENSMLUP00000007783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]