SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008132 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008132
Domain Number 1 Region: 119-233
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-21
Family Cadherin 0.00021
Further Details:      
 
Domain Number 2 Region: 442-559
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-16
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 358-441
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000012
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 33-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000314
Family Cadherin 0.0024
Further Details:      
 
Domain Number 5 Region: 258-319
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000957
Family Cadherin 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000008132
Domain Number - Region: 556-594
Classification Level Classification E-value
Superfamily Cadherin-like 0.000157
Family Cadherin 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008132   Gene: ENSMLUG00000008910   Transcript: ENSMLUT00000008924
Sequence length 598
Comment pep:putative scaffold:Myoluc2.0:GL430440:288909:317940:1 gene:ENSMLUG00000008910 transcript:ENSMLUT00000008924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAQLHCLCLLTLYLTTGRGQEGKFSGPLKPMTFSIFEGQEPSQIIFQFKASPPAVTFK
LTGETDGIFEIQPDGLLYHNRALDRETRAVHKLQVSALDAQGNTVEGPVPITVEVKDIND
NRPTFLQSKYEGSVRQNSRAGKPFMYVNATDLDDPDTPNGQLFYQIVMQLPKVNDVMYFQ
INNKTGAISLTLAGSKELDPSKNPFYSLVVSVKDMGGQTENSFSDSTSVDITVKENIWKA
PEPVEIVENSTDPHPIKITQVRWNEPGAHYSLVEKERLPRFPFSIDQEGDIYVTQPLDRE
EKDSYVFYAFAKDELGKPLLFPPESYEAQVLTTSTQGQTCATKVSICQQMPTDKGVSSIG
TLVAHDMDEENTVNSVLHYKIVDQFPKFPKDGLFLIQSYTGVFQLAMQSLKKQDASQYLL
TVEVSDKDFQTLCQVKINVIDINDQIPIFEKSDYGNLTLAEDTAVGSTILTIQATDADEP
FTGSSKILYRITQGDDEGRLGIDTDPQNNTGYVIIKKPLDFETTAIHNIVFQAENPEPLV
PGVQYNASSFATFTLFVTDVNEAPQFPLHIFQAKVSEDVAIGTKVGNMIAKDPEGLDI
Download sequence
Identical sequences G1PCJ1
ENSMLUP00000008132 ENSMLUP00000008132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]