SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008164 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008164
Domain Number 1 Region: 8-104
Classification Level Classification E-value
Superfamily SH2 domain 1.12e-20
Family SH2 domain 0.00068
Further Details:      
 
Domain Number 2 Region: 279-443
Classification Level Classification E-value
Superfamily Ras GEF 0.0000000000000523
Family Ras GEF 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008164   Gene: ENSMLUG00000008955   Transcript: ENSMLUT00000008957
Sequence length 571
Comment pep:putative scaffold:Myoluc2.0:GL430510:82954:90404:-1 gene:ENSMLUG00000008955 transcript:ENSMLUT00000008957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVPQNGEDFVSQPWYHGLLSRQKAEALLQRDGDFLVRASRTCGDHPVISCRWRGSALHF
EVLRVALRPRPGRPTALFQLEDERFPSLPALIRSYVNGQRPLTQATGAVASRPVIRQALI
DSPSRIELLRARKWSDSQPAGLEHVGRSREGHSEPGASTVPTLALSCMGSDPVLLKTPAP
LGSIADSLSASDGQLHAKAPTKPPRMSSLVLPDASEQPPTYCELVLRVPSARGTPPGHQC
PEPEAPWWEAQEEEEEEEEEEEERCFARPQADISFCHPSKSSGLLGPQNRPLEPKVLHTL
RSLFLEHHPGSTALHLLLADCKAAGLLGVTKAQRDAMGVASGLELLTLPHGHRLRSELLE
RHEVLVLAGALAVLGCTGTLEERTAALRGLVELALALRPGAAGDLPGLAAVMGVLLMPQV
SRLEQTWRQLRRSHTEAAVAFEQELKPLMRALDEGAGPCDPGEVALPHVAPAVRLLEGEE
VPGPLDESCEQLLRTLQGARQMAQDAPKFRKAAAQRLQGFRPNPDLQEALTTNFLRRLLW
GSRGEGAPRDSRLEKFQQVLSALSLRLEPDC
Download sequence
Identical sequences G1PCL7
ENSMLUP00000008164 ENSMLUP00000008164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]