SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008206 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008206
Domain Number 1 Region: 579-873
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-76
Family Protein kinases, catalytic subunit 0.0000238
Further Details:      
 
Domain Number 2 Region: 419-533
Classification Level Classification E-value
Superfamily PH domain-like 1.09e-34
Family Pleckstrin-homology domain (PH domain) 0.0000256
Further Details:      
 
Domain Number 3 Region: 137-206
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.42e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0007
Further Details:      
 
Domain Number 4 Region: 258-323
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.5e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008206   Gene: ENSMLUG00000008992   Transcript: ENSMLUT00000009006
Sequence length 893
Comment pep:putative scaffold:Myoluc2.0:GL429773:19104418:19154636:1 gene:ENSMLUG00000008992 transcript:ENSMLUT00000009006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSANNSPPSAQKSVLPATLPAVLPTPSSCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTI
SFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGMYDKILLFRHDLNSEN
ILQLITSCLPLHFGGALFPVLPGALATVEDFQIRPHTLYVHSYKAPTFCDYCGEMLWGLV
RQGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGLSVPRPLQTEYVALPTEE
SHVHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYTRPTICQYCKRLLKGLFRQG
MQCKDCKFNCHKRCASKVPRDCLGEVTFNGEPSSLGTESDIPMDIDSSDMNSDGGRGLDD
MEEPSPPEDKMFFLDPSDLDVERDEEAVKTISPSTSNNIPLMRVVQSIKHTKRKSSTMVK
EGWMVHYTSRDTLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPQDFTNISQ
GSNPHCFEIITDTMVYFVGENNGDSSHNPVLAATGIGLDVAQSWEKAIRQALMPVTPQAS
ICTSPGQGKDHKDLSTSISVSNCQIQENVDISTVYQIFADEVLGSGQFGIVYGEIGKHRK
TGRDVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLHG
DMLEMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAEPFPQVK
LCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIVYVSLSGTFPFN
EDEDINDQIQNAAFMYPPNPWKEISGEAIDLINNLLQVKMRKRYSVDKSLSHPWLQDYQT
WLDLREFETRIGERYITHESDDARWEIHAYTHNLVYPKHFIMAPNPDDMEEDP
Download sequence
Identical sequences G1PCQ3
ENSMLUP00000008206 ENSMLUP00000008206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]