SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008346 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008346
Domain Number 1 Region: 350-490
Classification Level Classification E-value
Superfamily C-type lectin-like 8.42e-41
Family C-type lectin domain 0.00026
Further Details:      
 
Domain Number 2 Region: 932-1083
Classification Level Classification E-value
Superfamily C-type lectin-like 9.28e-41
Family C-type lectin domain 0.00049
Further Details:      
 
Domain Number 3 Region: 645-779
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-39
Family C-type lectin domain 0.000000246
Further Details:      
 
Domain Number 4 Region: 789-925
Classification Level Classification E-value
Superfamily C-type lectin-like 5.95e-38
Family C-type lectin domain 0.00045
Further Details:      
 
Domain Number 5 Region: 1220-1358
Classification Level Classification E-value
Superfamily C-type lectin-like 1.45e-35
Family C-type lectin domain 0.00021
Further Details:      
 
Domain Number 6 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.05e-35
Family Cysteine rich domain 0.000000772
Further Details:      
 
Domain Number 7 Region: 499-638
Classification Level Classification E-value
Superfamily C-type lectin-like 8.61e-31
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 8 Region: 230-343
Classification Level Classification E-value
Superfamily C-type lectin-like 4.89e-30
Family C-type lectin domain 0.00091
Further Details:      
 
Domain Number 9 Region: 1091-1217
Classification Level Classification E-value
Superfamily C-type lectin-like 3.32e-29
Family C-type lectin domain 0.002
Further Details:      
 
Domain Number 10 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-19
Family Fibronectin type II module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008346   Gene: ENSMLUG00000009142   Transcript: ENSMLUT00000009158
Sequence length 1458
Comment pep:putative scaffold:Myoluc2.0:GL429888:1894228:1972304:-1 gene:ENSMLUG00000009142 transcript:ENSMLUT00000009158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKPLVQKFVGPKTKVNFLIDTRQFLIYNEDHKRCVEAVSPTAVQTAVCNPDSEAQKFRW
VSESQIMSIAFKLCLGVPSKTDWVPITLYACDSKSEFQKWECKNDTLLGIEGEDLFFNYG
NRQEKNIMLYKGSGLWSRWKIYGTTDDLCSRGYEVMYSLLGNANGAACVFPFKFKDKWYA
DCTKNGSSKGWYWCSTTADYDTDKLFGYCPLKFEGSQNLWNKDPLTGVSYQINSKSALTW
HQAWKSCQQQSAELLSITEIHEQTYMTGFTNSLTSGLWIGLNSLGSNSGWQWSGGSPFRY
LNWLPGSPSAEPGQSCVSLNPGKNAMWENLNCAQKLGYICKKGNATLNPFVIPLASDVPT
NCPPQWWPYTGNCYKIHREEKKIQRDALIACRKEGGDLASIHTIEEFDFIISQLGYEPND
ELWIGLNDLKIQMYFEWSDGTPVTFTKWLHGEPSHENNRQEDCVVMKGKDGYWADRACER
SLGYICKMKSQAHGPGIVEVEPGCRKGWKRHGFYCYMIGHTLSTFSEANQTCVKENAYLT
TVEDRYEQAFLTSWVGLRPEKYFWTGLSDVRNKGTFQWTIEEEVQYTHWNFEMPGRKAGC
VAMKTGIAGGLWDVLRCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPEDWGTTSKTSLCF
KLFTKGLHEKKTWFDSRDFCKALGGDLASINNKEEQQAIWRLITASGNYHELFWLGLTYE
SPSEGFTWSDGSPVSYENWSYGEPNNYGNAEYCGELKGDPTMSWNDINCEHLKNWICQIR
KGQTPKPEPTPTPEDNPPVTEDGWVIYKDYQYYFSKESETMDNAREFCKRNFGDLVSIQS
ESEKKFLWKYVNRMDAQPAYFIGLLISLDRKFSWMDESKVNFVAWAPGEPNFANDDENCV
VMYANSGLWNDINCGYPNPFICQRHNSSINATVIPTTPPAPGGCKEGWSFYNNKCLKIFG
FVEQERKTWQEARKACIGFGGNLVSIRNEREQAFLTYHMKDSTFNAWIGLNDVNSEHTFL
WTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGTKSKEAGKWMDDTCDSKRGYICQT
PPDSSLHHSPATVPTDGFIKYGESSYSLTKLKLQWHEAESYCKLHTSLMASILDPYSNAF
AWMQMQAFNEPVWIGLNSNLTNGEYAWIDKWRVRYTNWATDEPKLKTACVYLDPDGYWKT
AHCNESFYFLCKRSDEIPATEPPQLPGRCPESEPSAWIPFHGHCYYIESSYTRHWGQASL
ECLRMGASLVSIESAAESSFLSYRVEPLQSKTNFWIGLYRNVEGKWQWINNNPLSFVNWI
AGEPTGERNDCASLVASSGLWNSIHCSSYKGYICKRPKIIDAEPTHTLMTEKADPRKMEP
SKPSKPSSGVAGGVVVVILLIAVGAGLAAYMFYKKRRVHLPQESTFENTLYFNSRPSTGT
GDTKDLVSNIEQNEHAVI
Download sequence
Identical sequences G1PD26
ENSMLUP00000008346 ENSMLUP00000008346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]