SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009569 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009569
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 1.39e-36
Family Rap30/74 interaction domains 0.00000087
Further Details:      
 
Domain Number 2 Region: 175-242
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.67e-23
Family DNA-binding domain from rap30 0.000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009569   Gene: ENSMLUG00000010505   Transcript: ENSMLUT00000010497
Sequence length 249
Comment pep:putative scaffold:Myoluc2.0:GL429774:6019404:6150118:1 gene:ENSMLUG00000010505 transcript:ENSMLUT00000010497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKAPGRGEVGKLRIANIKILDEVSFTLNE
DLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSADKLSLEGIVVQRAECRPAA
SENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADK
QYVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGIQNVKGIHKNTWELKPEYR
HYQGEEKSD
Download sequence
Identical sequences G1PG30
ENSMLUP00000009569 ENSMLUP00000009569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]