SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009622 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009622
Domain Number 1 Region: 167-302,410-663
Classification Level Classification E-value
Superfamily Ras GEF 5.62e-86
Family Ras GEF 0.0002
Further Details:      
 
Domain Number 2 Region: 310-418
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.7e-33
Family Ras-binding domain, RBD 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009622   Gene: ENSMLUG00000010554   Transcript: ENSMLUT00000010557
Sequence length 665
Comment pep:putative scaffold:Myoluc2.0:GL430096:907590:919653:1 gene:ENSMLUG00000010554 transcript:ENSMLUT00000010557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPLEKFLKKQTSQLAGRTVAGGPGGGPGSCGGPGGGGGPGGGGGSAGGPRPLQRRQSVS
RLLLPAFLREPPAEPGLEPPPEEEGGEPAGVTEELGGSGGPCWLQLEEVPGPGPLGGGGP
LRSPSSYSSDELSPGEPLASPPWAPLGPERPEHLLNRVLQRLAGGATRDSAASDILLDDI
VLTHSLFLPTEKFLQELHHVGVSFVSAGGREGPEGLGQKQACLAMLLHFLDTYQGLLQEE
EGAGRIIKDLYLLIMKDESLYQDLREDTLRLHQLVETVELKIPEESQPPNKQVKPLFRHF
RRIDSCLQTRVAFRGSDEIFCRVYMPDHSYVTIRSRLSASVQDILGSVTEKLQYSEEPAG
REDSLILVAVASSGEKVLLQPTEDCVFTTLGINSHLFACTRDSYEALVPLPEEIQVSPGD
TEIHRVEPEDVANHLTAFHWELFRCVHELEFVDYVFHGERGRRETANLELLLQRCSEVTH
WVATEVLLCEAQGKRVQLLKKFIKIAAICKQNQDLLSFYAVVMGLDNAAVSRLRLTWEKL
PGKFKNLFRKFENLTDPCRNHKSYRDVISKMKPPVIPFVPLILKDLTFLHEGSKTLVDGL
VNIEKLHSVAEKVRTVRKYRSRPLCLDMEASPHHLQTKAYVRQFQVIDNQNLLFELSYKL
EANSQ
Download sequence
Identical sequences G1PG76
ENSMLUP00000009622 ENSMLUP00000009622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]