SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009789 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009789
Domain Number 1 Region: 453-632
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-47
Family SPRY domain 0.00097
Further Details:      
 
Domain Number 2 Region: 8-78
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-19
Family RING finger domain, C3HC4 0.0064
Further Details:      
 
Domain Number 3 Region: 148-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000458
Family B-box zinc-binding domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009789   Gene: ENSMLUG00000010740   Transcript: ENSMLUT00000010738
Sequence length 633
Comment pep:putative scaffold:Myoluc2.0:GL429925:1472713:1486819:-1 gene:ENSMLUG00000010740 transcript:ENSMLUT00000010738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSEYMSLAEELTCSICLELFKVPVTTPCGHNFCGSCLDETWTVQGAPFQCPQCRTEYPAR
PQLRKNTVLCTVVEQFAQAELARATAPDDWTPPSRAAAPSPTGQVACDHCLKAAAIKTCL
VCMASFCQEHLRPHFDSPAFRDHPLQPPVQDLFRRKCPQHNRLRDLFCPEHSECICHICL
VEHKTCSPVPLSQASADLEDKLKYKLTVMYGQINGAARALEDVRARQKDVREAAQKKMEQ
LRQEYLEMKALIDASEASSTRKIKEEEKRVSSKFDNIYQILLKKKAEMQTVKEEIEAALT
KGGEFEFLEKAAQLQAVSTKPVYVPKVELNHELIKGVSQSTADLKTELKRCLRKPEEPLT
SGTGEPAEHATAPTPKPTRPVKKVPKEEKKPKKVPPAAAAVSPNKLPTFGSSEQLGDLKQ
AGFEAAAKPTPVQPNSVSLKAKVLENFLAKSRPELLAYAVKVILDYNTAYSKVALSENYT
VASVAETHQSYRPHPQRFTYCSQVLGLHCYKKGIHYWEVELQKNNFCGMGICYGSMARQG
PESRLGRNNASWCVEWFNNKISAWHNNVEKILPTTKATRVGVLLNCDHGFVIFFAVALDR
IHVMYKYKEDFTEALYPAFWVFSTGATLSICSA
Download sequence
Identical sequences G1PGM1
ENSMLUP00000009789 ENSMLUP00000009789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]