SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009897 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009897
Domain Number 1 Region: 159-543
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.07e-158
Family Myotubularin-like phosphatases 0.00000000003
Further Details:      
 
Domain Number 2 Region: 35-155
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-41
Family GRAM domain 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009897   Gene: ENSMLUG00000010836   Transcript: ENSMLUT00000010858
Sequence length 603
Comment pep:putative scaffold:Myoluc2.0:GL429807:3287172:3363324:-1 gene:ENSMLUG00000010836 transcript:ENSMLUT00000010858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAPTSKYNSRSLENESIKRTSRDGVNRDLSEAVPRLPGEIRITDKEVIYICPFNGPIK
GRVYITNYRLYLRSLETDSALILDVPLGVISRIEKMGGATSRGENSYGLDITCKDMRNLR
FALKQEGHSRRDMFEILTRHAFPLAHSLPIFAFVNEEKFNVDGWMVYNPVEEYRRQGLPN
HHWRITFINKCYELCDTYPPLLVVPFRATDEDLKRVATFRSRNRIPVLSWIHPENKTVIV
RCSQPLVGMSGKRNKDDEKYLDVIRETNRQISKLTIYDARPSVNAVANKATGGGYESDDA
YHNTELFFLDIHNIHVMRESLKKVKDIVYPNVEESHWLSSLESTHWLEHIKLILTGAIQV
ADKVSSGRSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRSIEGFEILVQKEWISFGHKFAS
RIGHGDKNHADADRSPIFLQFIDCVWQMSKQFPTAFEFNERFLMTILDHLYSCRFGTFLY
NCESARERQKVTERTVSLWSLINSNKDTFKNPFYTKEINRVLYPVASMRHLELWVNYYIR
WNPRIKQQQPNPVEQRYMELLALRDEYIKRLEELQLANSAKLSDPSTSPSSPSQMLPHVQ
THF
Download sequence
Identical sequences G1PGW6
ENSMLUP00000009897 XP_006087798.1.53796 XP_006087799.1.53796 ENSMLUP00000009897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]