SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010075 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010075
Domain Number 1 Region: 3698-3856
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-32
Family SPRY domain 0.0016
Further Details:      
 
Domain Number 2 Region: 3500-3691
Classification Level Classification E-value
Superfamily Fibronectin type III 5.19e-22
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 3 Region: 3304-3353
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000801
Family B-box zinc-binding domain 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000010075
Domain Number - Region: 3344-3465
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.012
Family BAR domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010075   Gene: ENSMLUG00000011014   Transcript: ENSMLUT00000011056
Sequence length 3867
Comment pep:putative scaffold:Myoluc2.0:GL429767:35823478:35885614:-1 gene:ENSMLUG00000011014 transcript:ENSMLUT00000011056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLSDQDEEGKTKEKCIISDPSFSMVTVQREDSGITWETNSSRSSTPWASEESQTSGVCSL
EGSTINSTAGNVSFIVDEVKKARKRTSKSKHGSPSLRRKGNKKRNSFETQDVPANKKDSP
LISESQVLNTQNEKLSSGSYDTMRKKKTTSNTPPITGAIYKEHKPLVLRPVYIGTVQYKI
KMFNSVKEELIPLQFYGTLPKGYVIKEIHYRKGKDASVSLEPDMGNRDSNIVSKTGKLVG
QSIEDDKGKELTSPWRGALSKGSKSHTSLFSREDQKKIYPDSSLKAASAAKHTDSSYRSN
DTAEETQRSPPQSVPQQPGVEAKPHEMEPSSLMPDTSATAFLETAKEKFEPDSQEIVPSE
PESLVSPPFMDEVKKEDVYSTDHSVSPEAEKDSLETGAPGLAASIQEDIGPEREELDLTS
PERAEPVSEQLTSPQLDVKGEKEENVPEPPISLSEHLVSEKEEIETSVPIAATPEPEDSH
LVEEEIIELDYPESPSVSEKPLPPHLAPEVEQKEEEPILPSLTTSTPEHVALSEEEIEEN
ESVSTDSAFVSEHSVPQDMNHELEKQEVEPVSQSIVKATSEHAVLSEEENEEFEPYSASA
SEHSLSPSITEKTSECQSPLFSTVSGEEAAESGHYTPDSTSASEYSIPSQATKESLKNID
HKFPLESKGVSEHMILSEEEKEDTGLYSPDVASVAEHSLPPSTAEVTSEYQAPPLSATPS
EHVVLSEEELGNEHFTPDSTLNSQYIVPPNVTQEIPKKIIDDASLLKSKGVSEHITLSEE
EKEDTGLYSPDVASVAEHSLPPSTTEMPSEYQAPPLSATPSEHVIPSEEETVGMDRYTPS
SSQEEEIVHRSPLNLKGVSSPVNYSEEEQEDVEPFSPDSAFVSEFSFPPYATQETERREL
ECESPICLTSPSEHTILSDEDTEEAELFSPDSASQVSVPPYRIPETKKNEIEPDSLLPAV
SASGYSCFSEADEEEIESTAATPVPEHLSSSQKQQAEPSPPMSASGELSLPNKAEEADAQ
TFSTSVSEYLISLQKKVTQAFLEPESEDLIPPHLTSELEKGEIKTSSSVAATPVSVPAES
PTVKEETKPVSPSSQYSVSPDSVHALKKEQETKALLTPKAANEQMALFKVKSKEEILPDS
QEAAAHVSQDQEMEPQPPNVPGSGMKFSTLSDLVDEPKKDVKFNLAPTVTSELEQRIFSE
NEPEVIKPYSPLKEPPLSGPERLSAVKTEVKHDSKIIGVPRVPRSASPGVEKEVEPGPSA
PEFSEERKKEIEPSSSITTTSLAKHDSNLTKLAKEEIPTELPLTTPIEHSVLTVGKRELE
SGLPPSVTSMDEQLLLIDEGKIAIKASSPHIETVASKHPTWSEAEKEIKLDSPPSISSIS
EHTILSKVETEEVKPGLPVTKTLSSQHADVSKDARVENKQGLSFSTVLDSEPLALPQKKN
SVSASEVSGLSVNLGGEIKKKEAELPFSQNVSPAPKHEVPKGKTEKMASSSPKLETLVSE
DLAPTLPTVSDDKSKQAMDTSSTAQGDFLSEKQGLALAELSLEPVKKDKPRQISELPNAG
GLGRQSGSMDSKQIKSPMTETGGSVLGKGLAELRSRGEEEDRELHVSTTVPEISKVSSYL
KEKPPNQEIKSVSPNVVSLGSKEAFTSLVEGDNPEELQPYTFTLEGLSKELSHSVDFKKG
EKQEISSLLPTGNLKAQVTGDAVTTLKEETDQTHSFPVSQSIMKPSKMVSSDRLMEQEKP
ENTLYSDQAVKVPDVSTSFVAKQDLGIKQLAVMKENLPLEESKSFLTTECADVKETQMRE
ALISPEDENLILEKPERDLASHREERVLGSVQLGSSGSTDLETGQPKAALSSKDRAYETG
KQILPHSAEEPHLSLQEPVTTHDIPSGNVEILSTKTSSEEIKLVPQTKSFFPTGNVERNE
AEGKQVFSFTRSESSVLEKANTEFSRPCKDSQEEVKLPSERILQKPVSGPSMEQVKSETI
PSRAKAAPFLAEDAEPVVGNKKEALRSVSPLPGEKQLEESKMDQAKVVDDTNERGIPTSG
MKISTQIKTSILENKEPQPPESPEVTQKLPEQPKAVKPGHSEEKKKKGISSFTSWMSNLF
FRSSTPDNKVAEKEDLETQPSPSIEKAATVIEPKGTAPADLNATEKPAGQLLPEAKLITA
EESRGTLVKSEEGQDFKEKPTLSSNVEVLQQPESNFEVSSEDRGKKEMDLNSVVTSVDSE
EHFGIQSYSPMGEKSIMEEAKNVPDNKRAQKPEISSPSKWNISILKEEPRSDQKENSLFS
SDAVDKVTQQPKSISSSFTSENTRESEKPELIILPENSKGSLINLGEDRLTKEMPKPTSL
KISEEEVKLRSVSPTEEKDNLEIRSYSLAEKKVLAEKQETVTPLELRYNNEIEETPITHG
SPHIKLEESKAAAVLQQVCQNEDYKERHKITEEEKGKEKVKQLQAFSEGKKQQEIQPYSV
NIARTMPEKSDDSLSRSLGETQPFSLVKTTLTIEKSETMISETHPEIRETKVVGTQPSLL
EESKVLVEKTKTFPPVELPYRDELDGHSFPKEGNLVLEKSSRDMASHNEKKGQVTVSELS
KGGSVDSTKDNIKQGSPSKESKSLETPPSLLSSVKPQTLVSEASPEISTIKNQEISTEKK
QELTPDRHTVHTIQTSKVQTSEMSKQPVLVSKHHLGAVGAARVNEPHSPASSNYAEFIRN
ASTTNANKISREPEEEFTMTSKPAGLSEDQKSAFSIISEGCEILNIHAPAFISSVDQEES
EQMQDKLEYLEEKASLKTLPFPGDSEAVACHKTLKSKLDSDKKVTSLKENKQKETHETKE
EIATDSETGDLAFNQPTVPGEEDYFEKYTLIDYNISPDTEIQKASGKLNVEVKLSKEVTE
EAVSFPESSEESALEHEYDLVKLDESFYGLEKDYSKLSHSETQKSVVIQKSADRDSSKST
NRDVDSKSPGMPLFDTDEGVLSRTPIFPTTAKAINPELLEEPPALAFLYKDLYEEAVGEK
KKEGETASEGDSVNSEASFPSKNSDTDDGTGIYFEKYILKDDILHDTSVMEKDQDQGLEG
KSVGKDDSYQLIAAEREIGARFTTIWGERSLEEEQKASYREGEPVGHVETLDNVDTQRKA
PITEEVKVVTQKISYAIPFEDTPHVLESRDETSTQGNEAANANPEVILNVPVQVSFPEEE
FTSGATCVQETLQVEPQIMVLPEPSEDRLRSSPVQDEYEFAESLNYEVVTQDTLSEELYS
ESMPEDVLSQGKESFEHISGNEFVSEVEQSMSSEQNELGRERTEDQLSSELVTEKEQKEA
KKSQIDTYCYTCKSPISAVDKIFGTHKDHEVSTLDTAISVVKVQLAEFLENLQEKSLRIE
AFVSEIESFFNTIEENCSKNEKKLEEQNEEMMKKVLAQYDEKAQSFEEVKKKKMEFLHDQ
MVRFLQSMDAAKDTLETIVREAEELDETVFLSSFEEINERLLSAMESTASLEKMPAAFSL
FEHYDDSSARSDQMLKQVAVPQPPRLEPQEPNSATSTTIAVYWSINKEDVIDSFQVYCME
EPQDDQEVNDLVEEYRVTVKESYCIFEDLEPDRYYQVWVMAVNFTGCSLPSERAIFRTAP
STPVIRAEDCTVCWNTATIRWQPVNPEATETYTLEYCRQHSPEGEGLRSYSGIKGLQLKV
NLQPNDNYFFYVRAINTFGTSEQSEAALISTRAIGTRFRLLRETAHPALQISSNGTVISF
AERRRLTEIPSVLGEELPACGQHYWETTVTDCPAYRLGICSSSAVQAGALGQGETSWYMH
CSEPQRYTFFYSGIVSDVHVTERPARVGILLDYNHQRLLFINAESGQLLFIIRHRFNEGV
HPAFALEKPGKCTLHLGIEPPDSARHK
Download sequence
Identical sequences G1PHC9
ENSMLUP00000010075 ENSMLUP00000010075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]