SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010089 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010089
Domain Number 1 Region: 18-253
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.32e-58
Family Ankyrin repeat 0.0000798
Further Details:      
 
Domain Number 2 Region: 269-313
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000107
Family SOCS box-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010089   Gene: ENSMLUG00000011079   Transcript: ENSMLUT00000011070
Sequence length 318
Comment pep:putative scaffold:Myoluc2.0:GL430292:143176:162585:-1 gene:ENSMLUG00000011079 transcript:ENSMLUT00000011070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKE
RCVRVFLEHGADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTP
LHVAAHYGRDSFVRLLLEFKAEVDPLSDKGTTPLQLAIIRERSSCVKILLDHSANIDIQN
GFLLRYAVIKSNHSYCRMFLQRGADTNLGRLEDGQTPLHLSALRDDVLCARMLYSYGADT
NTRNYEGQTPLAVSLSISGSGRPCLDFLQEVTRQPRNLQDLCRIKIRQCIGLQNLKLLDD
LPIAKVIKDYLKHKFDGI
Download sequence
Identical sequences G1PHE0 L5LCW7 S7PIQ2
XP_006771804.1.95426 XP_014301826.1.53796 XP_014399093.1.60319 ENSMLUP00000010089 ENSMLUP00000010089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]