SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010395 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010395
Domain Number 1 Region: 18-163,192-256
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.09e-49
Family BAR domain 0.0082
Further Details:      
 
Domain Number 2 Region: 288-474
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.75e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010395   Gene: ENSMLUG00000011405   Transcript: ENSMLUT00000011410
Sequence length 693
Comment pep:putative scaffold:Myoluc2.0:GL430180:204093:217271:1 gene:ENSMLUG00000011405 transcript:ENSMLUT00000011410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKRQLHRMRQLAHTGSLGRTPETETAEFLGEDLQQVEQRLEPAKRAAHNVHKRLQACLQ
GQSGSDMDKRVKKLPLMALSTTMAESFKELDPDSSMGKALEMSCAIQNQLARILAEFEMT
LERDVLQPLNRLSEEELPAILKHKKSLQKLVSDWNTLKSRLSQAAKNSGSGQGLGGGPGS
YGHTTTANKVETLKEEEEELKRKVEQCKDEYLADLYHFATKEDSYANYFINLMEIQADYH
RKSLSSLDTALAELKENHSQAEPSPSMMAAPFSRVYGVSLGAHLQELGRDIALPIEACVL
MLLSEGVKEEGLFRLAAGASVLKRLKQTMASDPRNLQEFCSDPHAVAGALKSYLRELPEP
LMTFDLYDDWMKAASLKEPRARLEALQEVCGRLPQENFSNLSLLLFFVYRLAEDQEVNKM
TPSNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQNADTLFPGDINFNVS
GLFPAPSPQDQVSDRPASEELPAIAVPAPAPAPAPTLAPVPPKERTESEVPPRPASPKVS
RSPPEAAAPAEDMARRTKRPAPARPTMPPPQVSSTRSSPPAPSLSPASGSPVIPRALPRR
LVGSSLRAPTVPPPLPPMPPQPVRRQSRRSPASPSQTSPGPASPSPVSLSMPAQADLGEA
TEDGGGPEAVDGTPTPTAVPPQPRPRSLASETD
Download sequence
Identical sequences G1PI73
ENSMLUP00000010395 ENSMLUP00000010395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]