SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010515 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000010515
Domain Number - Region: 187-223
Classification Level Classification E-value
Superfamily HMG-box 0.00489
Family HMG-box 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010515   Gene: ENSMLUG00000011538   Transcript: ENSMLUT00000011539
Sequence length 223
Comment pep:putative scaffold:Myoluc2.0:GL430011:1215561:1220357:-1 gene:ENSMLUG00000011538 transcript:ENSMLUT00000011539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPVKVKVEKSELEMAKARNQLDAVLQCLLEKSHMDRERLDEEARKTPSDTHSKDCSIVA
TGKRPSARFPHQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR
AWMRNSPTVREHERSPSSPLPPLPEDEEGSEVTTSKSRDVYKLPPPTSLSTQASEPSPSP
STLIYRNMQRWKRIRQRWKEASHRNQLRYSESMKILREMYERQ
Download sequence
Identical sequences G1PII3
ENSMLUP00000010515 ENSMLUP00000010515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]