SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010748 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010748
Domain Number 1 Region: 647-841
Classification Level Classification E-value
Superfamily Sec7 domain 2.09e-76
Family Sec7 domain 0.00000156
Further Details:      
 
Domain Number 2 Region: 404-587,1103-1115,1149-1492
Classification Level Classification E-value
Superfamily ARM repeat 5.28e-26
Family HspBP1 domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010748   Gene: ENSMLUG00000011755   Transcript: ENSMLUT00000011796
Sequence length 1809
Comment pep:putative scaffold:Myoluc2.0:GL429844:1596996:1664371:1 gene:ENSMLUG00000011755 transcript:ENSMLUT00000011796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEIKVETEKQSPPHGEAKAGSSTLPPVKSKANFIEADKYFLPFELACQSRCPRIVNTSLD
CLQKLIAYGHLTGNAPDSTTPGKKLIDRIIETICGCFQGPQTDEGVQLQIIKALLTAVTS
QHIEIHEGTVLQAVRTCYNIYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQME
KERHRHHHHLLQSPVSHHEPESPHLRYLPPQTVDHISQEHERDLDPHTNDVDKSLQDDIE
PENGSDISSAENEQTEADQATAAETLSKNDILYDGENHDCEEKPQDIVQSIVEEMVNIVV
GDMGERTINANADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQE
SGNSSGPSPGAKFSHILQKDAFLVFRSLCKLSMKPLSDGPPDPKSHELRSKILSLQLLLS
ILQNAGPVFRTNEMFINAIKQYLCVALSKNGVSSVPEVFELSLSIFLTLLSNFKTHLKMQ
IEVFFKEIFLYILETSTSSFDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERL
VNDLSKIAQGRGSQELGMSNVQELSLRKKGLECLVSILKCMVEWSKDQYVNPNSQTTLGK
EKPSEQETSDIKHPETINRYGSLNSLESTSSSGIGSYSTQMSGTDNPEQFEVLKQQKEII
EQGIDLFNKKPKRGIQYLQEQGMLGTTPEDIAQFLHQEERLDSTQVGEFLGDNDKFNKEV
MYAYVDQHDFSGKDFVSALRMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASAD
TAYVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYNEIAGKKI
SLKETKELAIPTKSSKQNVANEKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHL
EHVRPMFKLAWTPFLAAFSVGLQDCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQA
LARFTLLTVSSGITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGT
GVKPRYISGTVRGREGSLTGTKDQAPDEFVGLGLGVVVGGNVDWKQIASIQESIGETSSQ
SVVVAVDRIFTGSTRLDGNAIVDFVRWLCAVSMDELLSTTHPRMFSLQKIVEISYYNMGR
IRLQWSRIWEVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRP
FEHIMKRNRSPTIRDMVVRCIAQMVNSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQ
TTGHIVTLVFEKHFPATIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRHCAKYVSDRPQ
AFKEYTSDDMNVAPEDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKTYGHTY
EKHWWQDLFRIVFRIFDNMKLPEQQTEKAEWMTTTCNHALYAICDVFTQYLEVLSDVLLD
DIFAQLYWCVQQDNEQLARSGTNCLENVVILNGEKFTLEIWDKTCNCTLDIFKTTIPHAL
LTWRPTSGETVPVPSSPVSEKQLDTISQKSVDIHDSIQPRSADNRQQATLASVSTVNEEA
NKIKPSAKYPEQKLFAALLIKCVVQLELIQTIDNIVFFPATSRKEDAENLAAAQRDAVDF
DVRDTQDQGMYRFLTSQQLFKLLDCLLESHRFAKAFNSNNEQRTALWESSFKGKSKPNLL
KQETSSLACGLRILFRMYMDESRVSAWEEVQQRLLNVCSEALSYFLTLTSESHREAWTNL
LLLFLTKVLKISDNRFKAHASFYYPLLCEIMQFDLIPELRAVLRRFFLRIGVVFQISQPP
EQELGLNKQ
Download sequence
Identical sequences G1PJ34
ENSMLUP00000010748 ENSMLUP00000010748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]