SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010770 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010770
Domain Number 1 Region: 71-122
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000445
Family Elafin-like 0.0014
Further Details:      
 
Domain Number 2 Region: 28-73
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000124
Family Elafin-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010770   Gene: ENSMLUG00000011821   Transcript: ENSMLUT00000011822
Sequence length 123
Comment pep:putative scaffold:Myoluc2.0:GL429857:3739684:3740148:1 gene:ENSMLUG00000011821 transcript:ENSMLUT00000011822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECRAGESRVSPYSRTLVCLQPQYLGGSLPERHGGCPPDDGPCLHSVPDQCVDDSQCPSKM
KCCHRSCFRQCVRRVTVKQGTCPEDRMHCLSPIQHLCHKDTDCRGSSRCCLGACGRDCRN
PVR
Download sequence
Identical sequences G1PJ55
ENSMLUP00000010770 ENSMLUP00000010770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]