SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010874 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010874
Domain Number 1 Region: 115-179
Classification Level Classification E-value
Superfamily beta-catenin-interacting protein ICAT 3.27e-25
Family beta-catenin-interacting protein ICAT 0.00097
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000010874
Domain Number - Region: 5-60
Classification Level Classification E-value
Superfamily Ferritin-like 0.0284
Family Ferritin 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010874   Gene: ENSMLUG00000011940   Transcript: ENSMLUT00000011936
Sequence length 195
Comment pep:putative scaffold:Myoluc2.0:GL430425:197265:201854:-1 gene:ENSMLUG00000011940 transcript:ENSMLUT00000011936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDADEYEETKKETLEQLSEFNDSLKKI
MSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLE
RDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKVLALASF
EVENKKMTWCGSLGQ
Download sequence
Identical sequences G1PJF0
ENSMLUP00000010874 ENSMLUP00000010874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]