SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000010950 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000010950
Domain Number 1 Region: 339-470
Classification Level Classification E-value
Superfamily C-type lectin-like 1.32e-41
Family C-type lectin domain 0.0000827
Further Details:      
 
Domain Number 2 Region: 197-332
Classification Level Classification E-value
Superfamily C-type lectin-like 3.54e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 775-914
Classification Level Classification E-value
Superfamily C-type lectin-like 2.7e-34
Family C-type lectin domain 0.0004
Further Details:      
 
Domain Number 4 Region: 480-616
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-33
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 5 Region: 927-1078
Classification Level Classification E-value
Superfamily C-type lectin-like 3.32e-32
Family C-type lectin domain 0.00041
Further Details:      
 
Domain Number 6 Region: 624-766
Classification Level Classification E-value
Superfamily C-type lectin-like 6.87e-30
Family C-type lectin domain 0.00044
Further Details:      
 
Domain Number 7 Region: 1218-1356
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-28
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 8 Region: 3-134
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.15e-24
Family Cysteine rich domain 0.0079
Further Details:      
 
Domain Number 9 Region: 1085-1212
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-22
Family C-type lectin domain 0.0028
Further Details:      
 
Domain Number 10 Region: 134-192
Classification Level Classification E-value
Superfamily Kringle-like 2.23e-20
Family Fibronectin type II module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000010950   Gene: ENSMLUG00000012007   Transcript: ENSMLUT00000012021
Sequence length 1454
Comment pep:putative scaffold:Myoluc2.0:GL429866:836782:861402:-1 gene:ENSMLUG00000012007 transcript:ENSMLUT00000012021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEPNVFLIFSYGLEGCLEAQGGQVRVSPHCSSSLPAQRWKWVSRNRLFNLGTMQCLGTGW
PGTNTTASLGMYECDREAMNLRWHCRTLGDQLNLLLGGRAGNTSKAGTPERGDQTRSGQW
SIYGSEEDLCARPYYEVYTIQGNSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQD
YGKDERWGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITE
IHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVI
RTESSGGWQNRDCSIALPYVCKKKLNAPAQPEPPDVWANVKVECEPSWQPFQGHCYRLQA
EKRSWQESKKACLRGGGDLLSIHSMAELEFITKQIKQAEVEELWIGLNDLKLQMNFEWSD
GSIVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQETTEE
DHGCRKGWKWHSPSCYWLGEDQVTYSEARRLCTDQGAQLVTITNRFEQAFVSSLIYNWDG
EYFWTALQDLNSTGSFRWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCTT
FWARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDPKLRHCYKVFSSERLQDKKRW
AQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGYHWFWIGLNRRDPSGGQSWRWSDGL
GFSYHNFDRSRHDDDDIRGCAVLDLASLQWVALQCETQLDWICKIPRGEAPLCTPTSPPQ
SSPERGRREWLRFQEAEYKFFEHHSTWTQAQRICTWFRAELASVHSQDELDFLGHSLQKF
SRGQEQHWWIGLHSSESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVYMTASREDWGD
QRCLTALPYVCKRSNKTRETQPLDLPPTVRGGCPSGWSQFLNKCFRIQGQDPQDRVKWSE
AQFSCEQQEAQLLTIANPLEQAFVTASLFNVTFDLWIGLHASQKDFQWVEPGPLLYANWA
PGEPSGPNPAPSGNIPTSCAVVLHSPSSHFTGRWDDRSCTEETHGFICQKDTDPLLSPSP
AASPPAPGTELSYLNGTFRLLQKPLRWHDALLLCESYNTSLAHVLEPYTQAFLTQAARGL
RAPLWIGLASEEGSRRYSWVSEEPLSYVGWQDREPQHIGGCAYVDVDGAWRTASCEAKLQ
GAVCGVHRGPPPRRINYHGSCPQDLAESSWIPFRDHCYSFHLELKLGHKEALQHCQRVGG
TVLSIRDEMENVFVWEHLQSSEDQSRGAWLGMNFNPKGGTLVWQDNTVVNYSNWGPPGLG
PSMLSHNSCYWIQSSSGQWRPGACTNITMGVVCKLPRVAKLDSKPVMAVLLDRGGVRLAT
AALPENPATLVVVLMAVLLLLALVTAALILYRRRQSVERGAFEGARYSRSSASGPGEATE
KNILVSDMEMNEQQ
Download sequence
Identical sequences G1PJL6
ENSMLUP00000010950 ENSMLUP00000010950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]