SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011035 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011035
Domain Number 1 Region: 15-157
Classification Level Classification E-value
Superfamily ENTH/VHS domain 2.78e-47
Family VHS domain 0.000000212
Further Details:      
 
Domain Number 2 Region: 585-723
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 2.48e-45
Family gamma-adaptin C-terminal appendage domain-like 0.0000089
Further Details:      
 
Domain Number 3 Region: 173-301
Classification Level Classification E-value
Superfamily GAT-like domain 3.34e-36
Family GAT domain 0.00000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011035   Gene: ENSMLUG00000012106   Transcript: ENSMLUT00000012112
Sequence length 727
Comment pep:putative scaffold:Myoluc2.0:GL429789:11030152:11058263:-1 gene:ENSMLUG00000012106 transcript:ENSMLUT00000012112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMRSEGEEMSSEWSDKATDPSMPEQDWSAIQNFCDQVNTDPNGPTHAPWLLAHKIQSPQE
KEALYALTVLETCVNHCGEKFHNEVAKFRFLNELIKVLSPKYLGSWTTEKVKGRVIEILF
SWTVWFPEDIKIRDAYQMLKKQGIVKQDPKLPVDKILPPPSPWPRSSIFDADEEKSKLLT
RLLKSSHPEDLQAANRLIKSLVKEEQEKSEKVSKRVSAVEEVRSHVKVLQEMLSRYRRPG
QAPPDQEALQVVYERCEKLRPTLFRLASDTVDDDDALAEILQANDLLTQGVLLYKQVMEG
RVIFGNTVTSTAGDTPDSRGNVQRASLYLLLGAASDPRHRSRWLIAPSGQAPRRGSELAK
PAGCVQAEWTTRGGLATGGKAVLWLLIPGPTQALCQALHLRWKVLGVLRVGCCDVLTGRR
PEKEVGILGSSERSSWHLVSAERSVLDLLSPQPPSGALRAGVTLEDGQRHRSAEASLLPS
PPFTTIPSEERTPLAKVSVEDLSIASSLEALGEVVIFSHHSTGASHSYFDGLLLSGLQFS
KMFSVCVANGQNPKEEVPPGTKSSPGWSWEAGPLASSSSSQNTPLAQVFVPLESVKPSSL
PPIIVYDRNGFRILLHFSQTGAPGHPEVQVLLLTMMSTATQPVWDIMFQVAVPKSMRVKL
QPASSSQLPAFSPLMPPAVISQMLLLDNPHKEPIRLRYKLTFNQGGQPFSEVGEVKDFPD
LAVLGAA
Download sequence
Identical sequences G1PJU4
ENSMLUP00000011035 ENSMLUP00000011035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]