SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011050 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011050
Domain Number 1 Region: 380-546,842-1060,1114-1154
Classification Level Classification E-value
Superfamily Ras GEF 3.92e-107
Family Ras GEF 0.00013
Further Details:      
 
Domain Number 2 Region: 527-614
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-20
Family PDZ domain 0.006
Further Details:      
 
Domain Number 3 Region: 258-382
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.58e-18
Family cAMP-binding domain 0.0011
Further Details:      
 
Domain Number 4 Region: 17-118
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000101
Family cAMP-binding domain 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000011050
Domain Number - Region: 752-831
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000413
Family Ras-binding domain, RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011050   Gene: ENSMLUG00000012113   Transcript: ENSMLUT00000012128
Sequence length 1614
Comment pep:putative scaffold:Myoluc2.0:GL430067:35200:212807:-1 gene:ENSMLUG00000012113 transcript:ENSMLUT00000012128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSPVDPGARQALKKKPPERTPEDLNTIYSYLHGMEILSNLREHQLRLMSARARYERYSG
NQILFCSETIARCWYILLSGSVLMKDSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVEN
SKDNEDNILQREIPARQSRRRFRKVNYKGERQTITDDVDINSYLSLPADLTKMHITDNPH
PQVTHVSSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDEEEEDEEI
DRTDPLQGRDLVRECLEKEPADKTDDDIEQLLEFMHQLPAFANMTMSVRRELCSVMIFEV
VEQAGAIILEDGQELDSWYVILNGTVEISHSDGKVENLFMGNSFGITPTLDKQYMHGVVR
TKVDDCQFVCIAQQDYWRILNHVEKNTHKVEEEGEIVMVHEHRELDRSGTRKGHIVIKAT
PERLIMHLIEEHSIVDPTYIEDFLLTYRTFLESPLDVGIKLLEWFRIDSLRDKVTRIVLL
WVNNHFNDFEGDPAMTRFLEEFEKNLEDTKMNGHLRLLNIACAAKAKWRQVVLQKASRES
PLHFSLNGGSEKGFGIFVEGVEPNSKAADAGLKRGDQIMEVNGQNFENITFVKALEILRN
NTHLALTVKTNIFVFKELLSRTEQEKSGVPHIPKIAEKKSNRHSIQDVPGDIEQAPQEKG
NKKVKANTVSGGRNKIRKILDKTRFSILPPKLFSDGGLSQSQDDSIVGTRHCRHSLAIMP
IPGTLSSSSPDLLQPTTSMLDFSNPSDIPDQVIRVFKADQQSCYIIISKDSTAKEVVCHA
VHEFGLTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLNGRYYLKNNMETETLC
SDEDAQELVKESQLSMLQLSTVELATQLSMRDFDLFRNIEPTEYIDDLFKLDSKTGNTHL
KEFEDIVNQETFWVASEVLTESNQLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLA
SVARLKGTWEKLPSKYEKHLQDLQDLFDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDM
TFLHEGNDSKVDGLVNFEKLRMIAKEIRQVVRMTSANMDPAMMFRQRKKRWRSLGSLSQG
STNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSSLDVETDEEKFQMMSL
QLEPAYGTLTKNLTEKRLAKSSEMSPVPLRSAGQTAKAHLHQPHRVSQVLQVPAVNLHPT
RKKGQSRDPVTLSTSSPQKVLGTTEEMSGKKHSEDTVSMTSSLHSSPPGSPQGSPRKGYT
LIPSAKLDNLSDSSHSEISSRSSIVSNCSVDSMSAALQDERCSSQVAAVPESTGLLERTE
HSSGTGAHSQLGPGWTLSKPSPIKSLAVSSSMSNEEISHEHIIIEAGDSGRGSWTSCSSS
SHDNFQSLPNPKGWDFLNSYRHTHLDGPIAEVEPTDCEPYSCPNSCSRTCGQCKGSLETN
QMRQSWASSSSLSDTYEPNYGTVKRRVLESTAAELSEGLDPKDGADPVYKTITSSTEKGL
IVYCVTSPKKEDRYREPPPTPPGYMGISLADLKEGPHLHLKPPDYSVAVQRSKMMHNSLS
RLPSASLSSNPMACVPSKIVTQPQRRSLQPSHPKLADVTDADSEADENEQVSAV
Download sequence
Identical sequences G1PJV8
ENSMLUP00000011050 XP_006100197.1.53796 ENSMLUP00000011050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]