SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011151 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011151
Domain Number 1 Region: 1-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-66
Family Ephrin receptor ligand binding domain 0.00000223
Further Details:      
 
Domain Number 2 Region: 594-889
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.23e-65
Family Protein kinases, catalytic subunit 0.0000000393
Further Details:      
 
Domain Number 3 Region: 891-963
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.12e-17
Family SAM (sterile alpha motif) domain 0.00085
Further Details:      
 
Domain Number 4 Region: 420-514
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000175
Family Fibronectin type III 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011151   Gene: ENSMLUG00000012236   Transcript: ENSMLUT00000012240
Sequence length 967
Comment pep:putative scaffold:Myoluc2.0:GL430027:1497606:1533633:1 gene:ENSMLUG00000012236 transcript:ENSMLUT00000012240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VILLDSKASQVELGWTALPSNGWEEISGVDEHDRPIRTYQVCNVLEPNQDNWLQTGWIGR
GRGQRIFVELQFTLRDCSSIPGAAGTCKETFNVYYLETEADLGRGRPRPGSSRPRKIDTI
AADESFTQGDLGERKMKLNTEVRELGPLSRPGFHLAFQDVGACVALVSVRVYFRAPWVVV
AAQTVAVAAAFQLAAAPLVGVVHSCVGSSGWRVLNFPTLHCSSVFHWLLPLSTCAVRLYL
RGTAPPPRTFHRSGAAVSNWIQAEGAPWDKEEHFSGGRHCEKGYRMRGNVTPWQLSLGFT
TIALFNLVPLAVSQVEMCRHPTSPSPPPSGHQLSRVVMVLFWVFDSFCIPVLTSEIGEKL
EVGLLDGYHLKLEAMLTHFSKVWAPCSCSSYSLLHKTLPACARSVITVSIPRPWEEDEIR
RDRVEPQSVSLSWREPIPAGAAGANGTEYEIRYYEKGQNEQTYSTVKTGAPAVTVTNLKP
ATRYIFQIRAASPGPSWETQSFSPSIEVQTPGEAASGSRDQSPAVVVTVVTISALLVLGS
VMSVLAIWRRPCSYGKGGQDAHDEEELYFHFKVPTRRTFMDPQSCGDPLQAVHLFAKELD
AKSVTVEKSLGAGRFGELCCGRLQLPGRQGLPVAVHTLREGCSDSQRLSFLAEALTLGQF
DHSNVVRLEGVVTRGSTLMIVTEYLSHGALDGFLRRHEGQMVAGQLLGLLPGLASAMKYL
SEMGYVHRGLAARRVLVSSGLICKISGFGRGPRDRAEAVYTTMSGRSPALWAAPETLQFG
HFSSASDVWSFGVVMWEVMAFGERPYWDMSSQDVIKAVEDGFRLPPPRNCPSPLHRLMLD
CWQKDPGERPRFSQIHSILSKMVQDPDPPKCATAPCPRPPTPLADRAFSTFPSFGSVGAW
LEALDLGRYKDSFTAAGYGSLEAVAAMTAQDLVSLGISSAEHREALLSGVSALRARVLQL
QGQGVQV
Download sequence
Identical sequences G1PK50
ENSMLUP00000011151 ENSMLUP00000011151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]