SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011160 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011160
Domain Number 1 Region: 534-749
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-105
Family Thrombospondin C-terminal domain 0.0000000869
Further Details:      
 
Domain Number 2 Region: 411-532
Classification Level Classification E-value
Superfamily TSP type-3 repeat 9.68e-35
Family TSP type-3 repeat 0.00000382
Further Details:      
 
Domain Number 3 Region: 35-79
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 1.27e-16
Family Assembly domain of cartilage oligomeric matrix protein 0.00014
Further Details:      
 
Domain Number 4 Region: 343-413
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000314
Family TSP type-3 repeat 0.00039
Further Details:      
 
Domain Number 5 Region: 273-354
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000131
Family TSP type-3 repeat 0.0002
Further Details:      
 
Domain Number 6 Region: 178-221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000349
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 95-235
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000022
Family Growth factor receptor domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000011160
Domain Number - Region: 239-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00149
Family EGF-type module 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011160   Gene: ENSMLUG00000012249   Transcript: ENSMLUT00000012254
Sequence length 762
Comment pep:putative scaffold:Myoluc2.0:GL430078:520385:528686:-1 gene:ENSMLUG00000012249 transcript:ENSMLUT00000012254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVRREGVKAACVLLLSLAALGASGQGQSQIPLGANLGPQMLRELQETNAALRDVRELLRQ
QVKEITFLKNTVMECDACGERSARXPGLSVRPLPQCAPGYCFPGVACTMTASGARCGPCP
AGFTGNGSHCTDINECNAHPCFPRVRCINTSPGFRCEACPSGYSGPAHEGVGLPFAKANK
QVCTDINECETGQHNCVPNSVCVNTRGSFQCGQCQPGFVGDQASGCRPRAQRLCPDGTPS
SCHEKADCVLERDGSKSCVCAIGWAGNGLLCGRDTDLDGFPDEKLRCSERHCRKDNCMTV
PNSGQEDVDRDGIGDACDPDADGDGVVNEEDNCPLVRNPDQRNSDDDKWADACDNCRTQK
NEAQKDTAQAGKGDACDDDIDGARIRNAMDNCPRVPNSDQKDGDGDGVGDVCDNCPQKSN
PDQRDVDHDFVGDACDSDQDQDGDGLQDSRDNCPTVPNSAQQDSDRDGQGDACDEDDDND
RVPDNRDNCRLVPNPGQEDSDRDGVGDACQGDFDADKVVDKIDVCPENAEVTLTDFRAFQ
TVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDD
YAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALW
HTGDTASQVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDT
TMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETQGLLQA
Download sequence
Identical sequences G1PK58
ENSMLUP00000011160 ENSMLUP00000011160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]