SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000011754 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000011754
Domain Number 1 Region: 527-637
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-19
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 2 Region: 168-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-16
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 
Domain Number 3 Region: 343-459
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000116
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 4 Region: 289-351
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000486
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 643-701
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000144
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 703-764
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000162
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 770-826
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000223
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 8 Region: 464-529
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000472
Family Complement control module/SCR domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000011754   Gene: ENSMLUG00000012916   Transcript: ENSMLUT00000012921
Sequence length 923
Comment pep:putative scaffold:Myoluc2.0:GL430247:646044:663914:1 gene:ENSMLUG00000012916 transcript:ENSMLUT00000012921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPKAQHQPPPQLLFLILLSCPWIQGLPVKEEEALLEPGSETPTVASEALAELLHGALL
RRGPEMGYLPGSDPDPTLATPPAGQTLAAPSLPRATEPGTGPLTTAVTPKEGRGAGPTAP
ELLTPPPGTTAPPLSGPTSPGPPLGPEGGEEETTTTIITTTTVTTTVTSPVLCNNNISEG
EGHIESPDLGSSTSRTLGLLDCTYSIHVYPGYGIEIQVQTLNLSREEELLVLAGGGAPGL
APRLLANSSMLGEGQVLRSPTNRLLLHFQSPRVPRGGGFRIHYQAYLLSCGFPPRPAHGD
VSVTDLHPGGTATFHCDSGYQLHGEETLICLNSTRPAWSGEPPSCMASCGGTIHNATLGR
IVSPEPGGAAGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLMVRSGGSPLSPVIYDS
DMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPE
YRPGALATFSCLPGYALEPPGPPNAIECVDPTEPHWNDSEPACKAMCGGELSEPAGVVLS
PDWPQSYSPGQDCVWGLHVQEEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQ
PRRRLLSSGPDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHG
DLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEITNGHRTTSD
AGFPVGSHVQYRCLPGYSLEGAAVLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGVPENG
YQTLYKHHYQAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLSKVAYEELQDNRK
LEVTQTTDPSRQLEGGNLALAILLPLGLVIVLGCGVYIYYTKLQGKSLFGFSGSHSYSPI
TVESDFSNPLYEAGDTREYEVSI
Download sequence
Identical sequences G1PLL4
XP_006103402.1.53796 ENSMLUP00000011754 ENSMLUP00000011754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]