SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012102 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012102
Domain Number 1 Region: 21-95
Classification Level Classification E-value
Superfamily HR1 repeat 5.23e-18
Family HR1 repeat 0.0036
Further Details:      
 
Domain Number 2 Region: 499-589
Classification Level Classification E-value
Superfamily PDZ domain-like 6.74e-17
Family PDZ domain 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012102   Gene: ENSMLUG00000013292   Transcript: ENSMLUT00000013302
Sequence length 685
Comment pep:putative scaffold:Myoluc2.0:GL429931:2622968:2665363:1 gene:ENSMLUG00000013292 transcript:ENSMLUT00000013302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYPPLPLSLKTINKKNFFKKGGCNPFAQTGRSKLQNQRAALNQQILKAVRMRTGAENLLK
AATNHKVREQVRLELSFVNSDLQMLKEELEGLNISVGVYQSTEETFTIPLIPLGLKETKD
VDFSVVLKDFILEHYSEDSYLYEDEIADLMDLRQACRTPSRDEAGVELLMSYFLQLGFVE
SRFFPPTRQMGILFTWYDSLTGVPVSQQNLLLEKASILFNTGALYTQIGTRCNRQTQAGL
EGAMDAFQKAAGVLNYLKETFTHTPSYDMSPAMLSVLVKMMLAQAQETVFEKICLPGIQN
EFFMLVKVAQEAAKVGEVYQQLHAAMSQAPVKENIPYSWASVACVKAHHYGALAHYFVAT
LLIDHQLKPGTDEDHQEKCLSQLYDHMPEGLTPLATLKNSNQRRQLGKSHLRKAIAHHEE
SVRGVSLCKKLRNIELLQEVLSVAHQRSQLKYTQHQEDDDLLNLIDVPDIISKTEQEVEI
IVPQFSKVTATDFFQKLGPLSVFSANKRWTPPRSIHFTAEEGDLGFTLRGNSPVQVHFLD
PYCSAALAGAKEGDYIVSIQNVDCKWLTVSEVMKLLKSFGEDDIEMKVVSLLDSTSSMHN
KCATYSVGMQKTYSMICLAIDDDDDKTGKTKKISKKLSFLSWGTNKNRQKSASTLCLPSV
GVVRPQVKKKLPSPFGLLNSDSSMY
Download sequence
Identical sequences G1PMH3
ENSMLUP00000012102 ENSMLUP00000012102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]