SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012318 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012318
Domain Number 1 Region: 10-154
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.23e-27
Family N-acetyl transferase, NAT 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012318   Gene: ENSMLUG00000013538   Transcript: ENSMLUT00000013536
Sequence length 169
Comment pep:putative scaffold:Myoluc2.0:GL429904:3445766:3451136:-1 gene:ENSMLUG00000013538 transcript:ENSMLUT00000013536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSSSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVC
CRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESA
IDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADAQKTDN
Download sequence
Identical sequences G1PN21
ENSCPOP00000012765 10141.ENSCPOP00000012765 ENSMLUP00000012318 ENSCPOP00000012765 ENSMLUP00000012318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]