SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012587 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012587
Domain Number 1 Region: 147-275
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-29
Family Cadherin 0.00028
Further Details:      
 
Domain Number 2 Region: 372-493
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-25
Family Cadherin 0.004
Further Details:      
 
Domain Number 3 Region: 261-376
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-22
Family Cadherin 0.00079
Further Details:      
 
Domain Number 4 Region: 481-589
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-16
Family Cadherin 0.0022
Further Details:      
 
Domain Number 5 Region: 76-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000228
Family Cadherin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012587   Gene: ENSMLUG00000013831   Transcript: ENSMLUT00000013834
Sequence length 775
Comment pep:putative scaffold:Myoluc2.0:GL429767:56325728:56379373:1 gene:ENSMLUG00000013831 transcript:ENSMLUT00000013834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTYHCLPLFIWTYMFYAVDAIPLQEKANSDLPSKRMMSLTKDDGKMLHRTKRGWMWNQF
FLLEEYTGTDTQYVGKLHTDQDKGDGNLKYILTGDGAGSIFVIDENTGDIHAAKKLDREE
KSLYILRAKAIDRKTGRQVEPESEFIIKIHDINDNEPKFTKDLYTASVPEMSGVGTSVIQ
VTATDADDANYGNSAKVVYSILQGQPYFSVDPESGVIKTALPDMSRENREKYQVVIQAKD
MGGQMGGLSGTTTVHITLTDVNNNPPRFPQSTYQFNSPESVPLGTHLGRIKANDPDVGEN
AEMEYSIAEGDGADMFDVITDKDTQEGIITVKQNLDFENKMLYTLRVDASNTHPDPRFLH
MGPFKDTAVVKISVEDIDEPPVFSKISYLIEVDEDVKEGSIIGQVTAYDPDATNNFIQYS
VDRHTDMDRIFSIHPENGSIFTLKPLDRESSPWHNITVIATEINNSKQSSHVPVFIRILD
INDHAPEFAMYYETFVCENAKPGQLIQTVSVMDKDDPPRGHKFFFEPVPEFPLNPNFTIV
DNKDNTAGIMTRKDGYSRHKMSTYLLPILIFDNDYPIQSSTGTLTIRVCACDQQGNMQSC
SAQALVLAAGLSTGALVAILLCVIILLVLVVLFAALKRQRKKEPLIISKDDVRDNQAFDI
GTLRNPEAREDSKLRRDVMPEAIFQIRRTVPLWENIDVQDFIHRRLKENDSDPSAPPYDS
LATYAYEGNDSIADSLSSLESLTADCNQDYDYLSDWGPRFKKLADMYGGDESDRE
Download sequence
Identical sequences G1PNQ2
ENSMLUP00000012587 ENSMLUP00000012587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]