SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013178 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013178
Domain Number 1 Region: 171-315
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-38
Family Third domain of FERM 0.0025
Further Details:      
 
Domain Number 2 Region: 68-173
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-30
Family Second domain of FERM 0.0000778
Further Details:      
 
Domain Number 3 Region: 2-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.96e-21
Family First domain of FERM 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013178   Gene: ENSMLUG00000014484   Transcript: ENSMLUT00000014488
Sequence length 550
Comment pep:putative scaffold:Myoluc2.0:GL430468:106278:209840:1 gene:ENSMLUG00000014484 transcript:ENSMLUT00000014488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQRETKGQFLIDHICNYYSLLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKSHPPYTMCF
RVKFYPHEPLKIKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIIQAELGDYDPDE
HPENYISEFEIFPKQSQKLERKMAEIHKSELRGQSPPVAEFNLLLKAHTLETYGVDPHPC
KDSTGTTTFLGFTAAGFVVFQGNKRTHLIKWPDVCKLKFEGKTFYVIGTQKEKKAMLAFH
TSTPAACKHLWKCGVENQAFYKYAKSSQIKTVSSSKIFFKGSRFRYSGKVAKEVVEASSR
IQREPPEVHRTNISQSRSSHSLNKQLIINMEPLQPLLPSPSEQEEDLPLREGIPLPKEDD
ISAPLISSSPVKEAREYEDPPSEEEDKIKEEPLTISELSYNPSASLLPTPVDDDEIDMLF
DCPSRHELEREDLDSFEELEADENAFLMAEEEELKEAHRALSWSYDILTGHIRVNPLVKS
FSRLLVVGLGLLLFVFPLLLLLLESGIDLSFLCEIRQTPEFEQFHYEYYCPLKEWVAGKV
NLILYMLGCS
Download sequence
Identical sequences G1PQ50
ENSMLUP00000013178 ENSMLUP00000013178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]