SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013684 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013684
Domain Number 1 Region: 216-332
Classification Level Classification E-value
Superfamily SH2 domain 9.56e-28
Family SH2 domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013684   Gene: ENSMLUG00000015032   Transcript: ENSMLUT00000015029
Sequence length 348
Comment pep:putative scaffold:Myoluc2.0:GL430777:239:6536:1 gene:ENSMLUG00000015032 transcript:ENSMLUT00000015029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKWLRDYLSFGGRRPPPQPPTPDYTESDILRAYLEQKNLDFEDPYEDADSRLEPDSAGP
GDSKYDSPKHRLIKVEAADMAEVARAKVLLGSAGAESEVDTEYSDPFDAQPHPPPPDDGY
MEPYDAQRVVSELPCRAVQLYDTPYEEQDGEPGDRPFSGQRPGQSRQPQEDERPADEYDQ
PWEWKKDHISKAFAVQFDSPEWERTPGSAKELRKPPPRSPHLAERVDPALPLEKQPWFHG
PLSRADAENLLLLCKEGSYLVRLSETSPQDCSLSLRSSQGFLHLKFAWTRENQLVLGQHS
GPFASVPELVLHYSSRPLPVQGAEHLALLYPVVTQSPCPGASAPGPAP
Download sequence
Identical sequences G1PRC7
ENSMLUP00000013684 XP_006107157.1.53796 ENSMLUP00000013684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]