SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014051 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014051
Domain Number 1 Region: 37-132
Classification Level Classification E-value
Superfamily SH2 domain 1.21e-26
Family SH2 domain 0.00000182
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000131
Family SOCS box-like 0.0000658
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014051   Gene: ENSMLUG00000015422   Transcript: ENSMLUT00000015420
Sequence length 198
Comment pep:putative scaffold:Myoluc2.0:GL429776:15928018:15930230:1 gene:ENSMLUG00000015422 transcript:ENSMLUT00000015420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRCVEPSGNGAEGTRSQWGTAGSAEEPSPEAAPLAKALRELSQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPPLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
Download sequence
Identical sequences G1PSB1
XP_006084090.1.53796 XP_006084091.1.53796 XP_006084092.1.53796 XP_006084093.1.53796 ENSMLUP00000014051 ENSMLUP00000014051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]