SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014214 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014214
Domain Number 1 Region: 118-226
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-27
Family Second domain of FERM 0.0023
Further Details:      
 
Domain Number 2 Region: 228-372
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-24
Family Third domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 16-118
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000372
Family First domain of FERM 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014214   Gene: ENSMLUG00000015602   Transcript: ENSMLUT00000015607
Sequence length 622
Comment pep:putative scaffold:Myoluc2.0:GL430071:64809:100851:-1 gene:ENSMLUG00000015602 transcript:ENSMLUT00000015607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLNFRNNRVMQDRRSVCIFLPNDKSLNIIINVKILCHQLLVQVCDLLRLKDCHLFGLS
VIQNNEHVYMELSQKLYKYCPKEWKKEASKVRQYEFSWGIDQFGPPMIIHFRVQYYVENG
KLISDRAARFYYYWHLKKQVLHSQCVLREEAYFLLAAFALQADLGNFKRDKHQGKYFEPE
AYFPSWVVAKRGKDYILKHIPNMHKDQFALTASEAHLKYIKEAVRLDDVAVHYYRLYKDK
REIEASLTLGLTMRGIQIFQNLDEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKL
IYYTGCPLRSRHLLQLLSNSHRLYMNLQPILRHIRKLEENEEKKQYRESYISDNLDLDMD
QLEKRSRASGSSVGSMKHKRLSRHSTASHSSSHTSGIEADTKPRDPGPEDSYSGSAIHRK
LKTCSSMTSHGSSHTSGVESGGKDRLEEDSQDDEIEMLVDDPRDLEQLNEDSLEVSPDMC
IYITEDMLLSRKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDR
HSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCVNIQDAFP
VKRTSKYFSLDLTHDEVPEFVV
Download sequence
Identical sequences G1PSQ4 S7PKX8
ENSMLUP00000014214 ENSMLUP00000014214 XP_005867948.1.60319 XP_006100286.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]