SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014255 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014255
Domain Number 1 Region: 208-357
Classification Level Classification E-value
Superfamily PH domain-like 8.91e-33
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 98-207
Classification Level Classification E-value
Superfamily Second domain of FERM 8.64e-24
Family Second domain of FERM 0.0017
Further Details:      
 
Domain Number 3 Region: 20-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-17
Family First domain of FERM 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014255   Gene: ENSMLUG00000015636   Transcript: ENSMLUT00000015650
Sequence length 893
Comment pep:putative scaffold:Myoluc2.0:GL430016:121804:263932:-1 gene:ENSMLUG00000015636 transcript:ENSMLUT00000015650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FYKNHLHRCTRALRHCILKNYVNRKLPVLGNPKLLAKELLDLVASHFNLKEKEYFGIAFT
DETGHLNWLQLDRRVLEHDFPKKSGPVVLYFCVRFYIESISYLKDNATIELFFLNAKSCI
YKELIDVDSEVVFELASYILQEAKGDFSSNEVVRSDLKKLPALPTQALKEHPSLAYCEDR
VIEHYKKLNGQTRGQAIVNYMSIVESLPTYGVHYYAVKDKQGIPWWLGLSYKGIFQYDYH
DKVKPRKIFQWRQLENLYFREKKFSVEVHDPRRASVTRRTFGHSGIAVHTWYACPALIKS
IWAMAISQHQFYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTSKLANMGSKGKIISGSS
GSLLSSGSQESDSSQSAKKDMLAALKSRQEALEETLRQRLEELKKLCLREAELTGKLPVE
YPLDPGEEPPIVRRRIGTAFKLDEQKILPKGEEAELERLEREFAIQSQITEAARRLASDP
NVSKKLKKQRKTSYLNALKKLQEIENAINENRIKSGKKPTQRASLIIDDGNIGSEDSSLS
DALVLEDGKTQVLLLGQRPPSSHNRPPPPQSLEGLRQMHYHRNDYDKSPLKPKMWSESSL
DEPYEKVKKRSSHSHSSMPSTPDLRVRSPQSVDLSPTRLHSLALHFRHRSSSLESQGKLL
GSENDTGSPDFYTPRTRSSNGSDPMDDCSSCTSHSSSEHYYPAQMNANYSTLAEDSPSKA
RARQRQRQRAAGSLGTANSGSMPNLAARGGGGNAPGVYLHSQSQPSSQYRIKEYPLYIEG
GATPVVVRSLESDQEGHYSVKAQFKTSNSYTAGGLFRESWRASEEGDAGRLTPSRSQILG
TPSLGRECAHDRGTGRTAVSDELRQWYQRSTASHKEHSRLSHTSSTSSDSGSQ
Download sequence
Identical sequences G1PSU1
ENSMLUP00000014255 ENSMLUP00000014255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]