SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014382 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014382
Domain Number 1 Region: 614-908
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-82
Family Protein kinases, catalytic subunit 0.000000000583
Further Details:      
 
Domain Number 2 Region: 30-203
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-75
Family Ephrin receptor ligand binding domain 0.000000831
Further Details:      
 
Domain Number 3 Region: 328-532
Classification Level Classification E-value
Superfamily Fibronectin type III 5.38e-40
Family Fibronectin type III 0.00013
Further Details:      
 
Domain Number 4 Region: 911-982
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.27e-21
Family SAM (sterile alpha motif) domain 0.0000429
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000014382
Domain Number - Region: 269-303
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0167
Family TNF receptor-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014382   Gene: ENSMLUG00000015777   Transcript: ENSMLUT00000015787
Sequence length 987
Comment pep:putative scaffold:Myoluc2.0:GL429770:20468480:20596602:-1 gene:ENSMLUG00000015777 transcript:ENSMLUT00000015787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIFYFVLFSFLFGTCNAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIM
DEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKE
TFNLYYYESDNDKERFIRESQFAKIDTIAADESFTQVDIGDRIMKLNTEVRDVGPLSKKG
FYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEK
DVPKMYCGADGEWLVPIGNCLCNAGHEERNGECQACKIGYYKALSTDATCAKCPPHSYSV
WEGAISCTCDRGFFRADSDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDI
SYNVVCKKCGAGDSSKCRPCGSGVHYTPQQNGLKTTKVSITDLLAHTNYTFEIWAVNGVS
KYNPSPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYE
KDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRII
GDGANSTVLLVSVAGSVVLVVILIAAFVISRSRRSKYSKAKQEADEEKHLNQGVRTYVDP
FTYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGY
TDKQRRDFLSEASIMGQFDHPNIIHMEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFT
VIQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAY
TTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEE
GYRLPPPMDCPISLHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPSSLKRTGTESSRPN
TALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHMNQDDLARIGITAV
THQNKILSSVQAMRTQMQQIHGRMVPV
Download sequence
Identical sequences G1PT48
ENSMLUP00000014382 ENSMLUP00000014382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]