SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014843 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014843
Domain Number 1 Region: 154-262
Classification Level Classification E-value
Superfamily Cadherin-like 2.05e-26
Family Cadherin 0.00021
Further Details:      
 
Domain Number 2 Region: 380-483
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-23
Family Cadherin 0.0038
Further Details:      
 
Domain Number 3 Region: 264-378
Classification Level Classification E-value
Superfamily Cadherin-like 1.33e-22
Family Cadherin 0.00067
Further Details:      
 
Domain Number 4 Region: 69-161
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000228
Family Cadherin 0.0048
Further Details:      
 
Domain Number 5 Region: 484-598
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000286
Family Cadherin 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014843   Gene: ENSMLUG00000016285   Transcript: ENSMLUT00000016289
Sequence length 798
Comment pep:putative scaffold:Myoluc2.0:GL429946:477648:523101:1 gene:ENSMLUG00000016285 transcript:ENSMLUT00000016289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKMKENYCLQAALVCLGVLCHSQAFSTERRSHLRPSFHGHHEKGKEGQVLQRSKRGWVWN
QFFVIEEYTGPDPVLVGRLHSDIDSGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDR
EERAQYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHETYHANVPERSNVGTSV
IQVTASDADDPTYGNSAKLVYSILEGQPYFSVEAQTGIIRTALPNMDREAKEEYHVVIQA
KDMGGHMGGLSGTTKVTITLTDVNDNPPKFPQSVYQMSVSEAAVPGEEVGRVKAKDPDIG
ENGLVAYNIVDGDGMELFEITTDYDTQEGVVKLKKPVDFETKRAYSLKVEAANVHIDPKF
ISNGPFKDTVTIKIAVEDADEPPMFLAPSYIHEVQENAAAGTVVGRVHAKDPDAANSPIR
YSIDRHTDLDRFFTINPEDGFIKTTKPLDREETAWLNISVFAAEIHNRHQEAKVPVSIRV
LDVNDNAPKFTAPYEGFICESDQSKPLSNQPIVTISADDKDDTANGPRFIFSLPPEIIHN
PNFTVIDNRDNTAGVYARHGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIRVCGCDVN
GALLSCNAEAYILNAGLSTGALIAILACIVILLVIVVLFVTLRRQKKEPLIVFEEEDVRE
NIITYDDEGGGEEDTEAFDIATLQNPDGINGFIPRKDIKPEYQYMPRPGLRPAPNSVDVD
DFINTRIQEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESATTDSDLDYDYLQNWGPR
FKKLADLYGSKDTFDDDS
Download sequence
Identical sequences G1PU94
ENSMLUP00000014843 ENSMLUP00000014843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]