SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015041 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015041
Domain Number 1 Region: 543-784
Classification Level Classification E-value
Superfamily VPS9 domain 5.75e-55
Family VPS9 domain 0.001
Further Details:      
 
Domain Number 2 Region: 95-219
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-16
Family SH2 domain 0.0017
Further Details:      
 
Domain Number 3 Region: 801-882
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000196
Family Ras-binding domain, RBD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015041   Gene: ENSMLUG00000016498   Transcript: ENSMLUT00000016505
Sequence length 906
Comment pep:putative scaffold:Myoluc2.0:GL429972:757845:825951:1 gene:ENSMLUG00000016498 transcript:ENSMLUT00000016505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTAHTQSHTKGMDQRFSFYVILIDTIASEIGELKQEMVQTDVSLENGLEPTEAHSMVRHK
DDGCSQEKDVKTCPRDSGYDSLSSRLSILDRLLHTHSIWLQLNLSEEEAAEVLQSQPPGI
FLVRKSTKMQKKVLSLRLPCEFGSPLKEFAIKESTYTFSLEGSGISFADLFRLIAFYCIS
RKIRDVLPFTLKLPYAISTAKTEAQLEELAQLGLNFWSSPADNKPPNPPPPHRPPSSDGV
CPASRQLCLINGVHSIKTRTPSELECSQTNGALCFINPLFLKVHSQDLSGGLKRPCTRTP
NANGTERPRSPPPRPPPPAINSLHTSPQLSRTETRAGMPETVNHNKHGNVALLGTKPTPI
PPPRLKKQASFLQAGGGAKTLTSSQPGGDRARELPQEQEPSAAGSPGGAPPAEAPGDCTR
AQPACSESRPPWHGGRQRLSDMSISTSSSDSLEFDRSMPLFGYEADTNSSLEEDYEEESD
QETMAPPIKSKKKRNSSFVLPKLFKSQLRKMSGVFSSFMTPEKRMVRRISELSRDKCTYF
GCLVQDYVSFLQENKECHVSSTDLLQTIRQFMTQVKNYLSQSSELDPPIESLIPEDQIDV
VLEKAMHKCILKPLKGHVEAMLKDFHMADGSWKQLKENLQLVRQRNPQELGVFAPTPDFV
DVEKIKVKFMTMQKMYSPEKKVMLLLRVCKLIYTVMESNSGRMYGADDFLPVLTYVIAQC
DMLELDTEIEYMMELLDPSLLHGEGGYYLTSAYGALSLIKNFQEEQAARLLSSETRDTLR
QWHKRRTTNRTIPSVDDFQNYLRVAFQEVNSGCTGKTLLVRPYVTTEDVCQLCAEKFKVG
DPEEYRLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHIFHFVYKRIKNDPYGVIFQNGE
EDLPTS
Download sequence
Identical sequences G1PUS1
ENSMLUP00000015041 ENSMLUP00000015041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]