SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015244 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000015244
Domain Number - Region: 116-188
Classification Level Classification E-value
Superfamily Cadherin-like 0.000675
Family Dystroglycan, N-terminal domain 0.04
Further Details:      
 
Domain Number - Region: 3-32
Classification Level Classification E-value
Superfamily DNA-binding domain of EIN3-like 0.0641
Family DNA-binding domain of EIN3-like 0.0098
Further Details:      
 
Domain Number - Region: 190-224
Classification Level Classification E-value
Superfamily Photosystem I reaction center subunit X, PsaK 0.0785
Family Photosystem I reaction center subunit X, PsaK 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015244   Gene: ENSMLUG00000016724   Transcript: ENSMLUT00000016727
Sequence length 473
Comment pep:putative scaffold:Myoluc2.0:GL429782:3470140:3534140:-1 gene:ENSMLUG00000016724 transcript:ENSMLUT00000016727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFPPWWELGDPCAWTGQGRGTRRMSPWTTGTFLLTAFLLSSADGISGTVNWKTKQANNF
IVSRKMAAGKKHVYTIFSKVHSDRDVYPSAGVLFVHVLERESFKGEFPPYPKPGEISNDP
ITFNTNLMGYPDRPGWLRYIQRTPYSDGVLYGSPTAENVGKPTIIEITAYNRRTFETARH
NLIINIMSAEELDFPLPYQAEFFIKNMNVEEMLASEVLGDFLGAVKNVWQPERLNAINIT
SALDRGGRVPLPINDMKEGVYVMVGADVPFSSCLREVENPQNQLRCSQEMEPVITCDKKF
RSQFYIDWCKISLVDKTKQVSTFQEVIRGEGILPDGGEYKPPSDSLKSRDYYTDFLITLA
VPSAVALVLFLILAYIMCCQREGVEKRNMQTPDIQLVHHSAIQKSTKELRDMSKNREIAW
PLSTLPVFHPVTGEIIPPLHADSYESTNMPLMQTQQNLPHQTQIPQQQTTGEC
Download sequence
Identical sequences G1PV97
ENSMLUP00000015244 ENSMLUP00000015244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]