SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015414 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015414
Domain Number 1 Region: 1-278
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 5.75e-57
Family Bacterial PLC 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015414   Gene: ENSMLUG00000016916   Transcript: ENSMLUT00000016913
Sequence length 287
Comment pep:putative scaffold:Myoluc2.0:GL429835:4943806:4986459:-1 gene:ENSMLUG00000016916 transcript:ENSMLUT00000016913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSHDSFSFYIDEASPVGPEQPETVQNFVSVFGTVAKKLMRKWLATQTMNFTGQLGAGIRY
FDLRISTKPRDPDNELYFAHGLFSAKVNEGLEEINAFLTDHRKEVVFLDFNHFYGMQKYH
HEKLVQMLKDIYGNKMCPAIFAQEVSLKYLWEKDYQVLVFYHSPVALEVPFLWPGQMMPA
PWANTTDPEKLIQFLQASITERRKKGSFFISQVVLTPKASTVVKGVASGLRETITERALP
AMMQWVSTQKPGESGINIVTADFVELGDFISTVIKLNYVFDEGEANT
Download sequence
Identical sequences G1PVN7
ENSMLUP00000015414 ENSMLUP00000015414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]