SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016002 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016002
Domain Number 1 Region: 161-247
Classification Level Classification E-value
Superfamily SH2 domain 9.05e-48
Family SH2 domain 0.00000905
Further Details:      
 
Domain Number 2 Region: 75-160
Classification Level Classification E-value
Superfamily EF-hand 2.24e-40
Family EF-hand modules in multidomain proteins 0.0001
Further Details:      
 
Domain Number 3 Region: 255-306
Classification Level Classification E-value
Superfamily RING/U-box 1.88e-25
Family RING finger domain, C3HC4 0.00073
Further Details:      
 
Domain Number 4 Region: 4-74
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 4.18e-18
Family N-terminal domain of cbl (N-cbl) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016002   Gene: ENSMLUG00000017546   Transcript: ENSMLUT00000017550
Sequence length 306
Comment pep:putative scaffold:Myoluc2.0:GL431981:480:9740:-1 gene:ENSMLUG00000017546 transcript:ENSMLUT00000017550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGATQDLLFLSLANLEAKSRPVTALLPPRDKSASDELYREGSMLRRQLAKLALIFSYMYS
ELSALFPGGKYCGHTYQLTKTEAHAFWREHCGARCVLPWAEFQSLLCTCHPVESGCTALA
LRSTIDLTCSGHVSIFEFDIFTRLFQPWPTLLRNWQLLAVDHPGYMAFLTYDEVRARLQD
CRDKPGSYIFRPSCTRLGQWAIGHVSSDGSILQTIPHNKPLFKALLEGQKEGFYLYPDGK
NHNPDLTEFCHMEAHQLIHVSEEQLQLYWAMNSTFELCKICAEANKDVKIEPCGHLLCSR
CLAAWQ
Download sequence
Identical sequences G1PX47
ENSMLUP00000016002 ENSMLUP00000016002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]