SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017070 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017070
Domain Number 1 Region: 440-565
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-30
Family Cadherin 0.0018
Further Details:      
 
Domain Number 2 Region: 235-339
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-28
Family Cadherin 0.0008
Further Details:      
 
Domain Number 3 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 1.07e-24
Family Cadherin 0.0044
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-23
Family Cadherin 0.0057
Further Details:      
 
Domain Number 5 Region: 556-666
Classification Level Classification E-value
Superfamily Cadherin-like 3.53e-17
Family Cadherin 0.001
Further Details:      
 
Domain Number 6 Region: 30-115
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000671
Family Cadherin 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017070   Gene: ENSMLUG00000030560   Transcript: ENSMLUT00000024094
Sequence length 810
Comment pep:putative scaffold:Myoluc2.0:GL429795:4436712:4439141:-1 gene:ENSMLUG00000030560 transcript:ENSMLUT00000024094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPERGRNYRGFLLLSILLGTRSEAWAGHILYSVPEETDKGSFVGNIAKNLGLEAQELA
ERGVRIVSRGRTQLFALNKRTGSLVTAGRIDREELCAQSARCLVSFNILIEDKMNLYPIE
VEIMDVNDNAPRFLTEEMNVKIMENTAPGVRFPLKEARDPDVGTNSLQSYQLSPNRHFSL
LVQTGEDGTKYPELVLERVLDREEEAIHHLLLTASDGGDPPLSGTARIQVAVVDVNDHAP
VFSLPQYQVTVPENVPVGTRLLTVNAIDLDEGVNGEVTYSFWKITPKILQIFQLNSHTGE
LSTLESLDYEESSYYEMEVQAQDGPGSMTRAKVRVTILDVNDNAPEVTITSVSSSIPEDT
PPGTVIALFYFQDRDSGKNGEVTCTISENLPFKLERSIDNYYRLVTAKNLDREILSVYNI
TLKTTDGGTPPLSTETHISIKVSDTNDNPPSFPHSAYSVYVPENNPRGASIFTVTAHDPD
SDENARVTYSLDEDTIQGVPLSSYVSINSDTGVLYALHSFDYEQFRDLQLRVTAHDSGDP
PLSSNVSLSLFVLDQNDNAPEILYPAIPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQ
NAWLSYRLLKASEPGLFVVGLHTGEVRTARALLDRDALKQSLVVAVQDHGQLPLSATVTL
TVAVADSIPDVLADLGSLEVSHDSEASGLTLYLVVAVAVVSCVFLAFVIILLALRLRRWS
TSRMLQASGGGFAGVPASHFVGVDGVHAFLQTYSQEVSLTADSGKSHLIFPQPNYADTLI
SDDSCEKKDPFLAPIDFHECKDEAQSIQVS
Download sequence
Identical sequences G1Q038
ENSMLUP00000017070 ENSMLUP00000017070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]